KEGG   Sanguibacter keddieii: Sked_01080Help
Entry
Sked_01080        CDS       T01214                                 

Definition
sugar kinase, ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ske  Sanguibacter keddieii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sked_01080
Enzymes [BR:ske01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sked_01080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111659..112708
Genome map
AA seq 349 aa AA seqDB search
MAGGPPAAHGRTGVVVVGSVNADLLTTVEQHPRPGETVLGRTLDVLPGGKGANQAVAAAQ
LGAQTTLVGAVGTDQFAEPALAGLRAAEVDLEAVAVVEGATGVAQVTVSADGENAIVVIP
GANASVDGAVVDARAAVIAGAAVVVVQGEIPRTGIEAAARHTSGRLVVNLAPVVDVDREV
LLAADPLVVNEHEAALVLAALDGESGIAERDAGATGATGATGATGADGERQDAEDDEQRV
VDALLAHGVPSVVLTVGARGALVADGSGTTRVPSPRVDAVDTTGAGDAFVGALAHRLSEG
EGLVEAARLAARVGAYAVRGSGAQPSYPWAGDALPEVEDVDRSDRGAAS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtggccgggggaccacccgcagcgcacggccggaccggtgtggtggtcgtcgggtcggtc
aacgccgacctgctcaccacggtcgagcagcacccgcgccccggcgagaccgtcctcggc
cgcacgctcgacgtgctgcccggcggcaagggggccaaccaggccgtcgccgccgcgcag
ctcggcgcgcagaccacgctcgtgggggccgtcggcacggaccagttcgcggagccggcg
ctggccggcctgcgggccgccgaggttgacctcgaggccgtggctgtcgtggagggggcc
accggcgtcgcgcaggtgaccgtctccgccgacggggagaacgccatcgtcgtgatcccc
ggggcgaacgcgtccgtggacggtgcggtggtcgacgcacgggcagcggtgatcgccggt
gcggccgtggtggtcgtgcagggcgagatcccgaggaccgggatcgaggccgccgctcgg
cacaccagcgggcggctcgtcgtgaacctcgcgcccgtggtcgacgtggaccgcgaggtc
ctgctggccgcggacccgctcgtcgtcaacgagcacgaggcggcgttggtgctcgcggcg
ctcgacggggagtcgggcatcgctgagcgagatgctggtgcgaccggtgcgaccggtgcg
accggtgcgaccggtgctgacggtgagcggcaggatgcagaggacgacgagcagcgggtc
gtcgacgcgctgctcgcgcacggcgtcccgtccgtggtgctcacggtcggggcgcgggga
gcgctcgtcgccgacgggtccgggaccacccgggtgccgtcgccgcgcgtcgacgcggtc
gacacgacgggggccggcgacgcgttcgtcggtgcgctcgcccatcggctgtccgagggg
gaagggctggtcgaggcggcgaggctcgctgctcgcgtcggtgcgtacgccgtgcggggg
agcggcgcgcagccgtcctacccctgggcgggggacgcgctgcccgaggtcgaggacgtc
gaccgcagcgaccgcggggccgcgtcgtga

DBGET integrated database retrieval system