KEGG   Sanguibacter keddieii: Sked_01440Help
Entry
Sked_01440        CDS       T01214                                 

Definition
cellobiohydrolase A
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ske  Sanguibacter keddieii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ske00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149262..150581
Genome map
AA seq 439 aa AA seqDB search
MARRSSDEPDAPQGPRDPRDPRYVIRVPLEETPEEPEVVPVRGGRTEAPEQRPASDYVIR
AAEPPQQPARTEPPRQPAPVVPQDETGLGDEAASAAPASVRLRKSRRRHPADRPPRIPRR
RLSRPVRWALVLGSVVLLAGVAALVVVRTGLLDDPNPFAGRDLYVDPESEAIKAVDAATD
AATRDAFLTIADQPTAIWLTPEEYPAGEVGPYVAQVVADAEAGDTLPVFVVYGIPDRDCG
QFSAGGTTVDGYETWVREIATALEGTETPVVLEPDALQLAEECGDVERRLGLVSTAGSVL
TGAGATVYLDGGHSNWHSVQESADLLRRAGVADVHGFATNVSNYNDDASELAYAERLSAQ
LDGAPFVVDTGRNGNGSDGTWCNPPGAALGAPPLTLEAEGLDANLWVKPPGESDGTCEGG
PVAGQWWPDRALSLVAGAR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaggagcagcgacgagcccgacgccccgcaggggccccgggacccgcgcgac
ccccgctacgtgatccgcgtcccgctcgaggagacgcccgaggagcccgaggtcgtgccc
gtccgcggcggtcgcaccgaggcccccgagcagcgcccggcgagcgactacgtgatccgg
gcggccgagcctccgcagcagcctgcccgcaccgagcctccgcggcagcccgcacccgtc
gtcccgcaggacgagaccggcctcggagacgaggcggcctcggcggctccggcgtccgtg
cgtctgcggaagagccgtcgacggcacccggcggaccgccctccccgcatcccccgacgg
cggctgtcgcgccccgtccgctgggcgctcgtcctgggctccgtcgtcctcctcgcaggc
gtcgcggcgctcgtcgtcgtgcgcaccggcctgctcgacgaccccaaccccttcgccggg
cgggacctctacgtcgaccccgagtccgaggcgatcaaggccgtcgacgccgcgaccgac
gcggccacgcgcgacgccttcctcaccatcgccgaccagccgaccgccatctggctgacg
cccgaggagtacccggcgggtgaggtcgggccctacgtcgcgcaggtcgtggcggacgcc
gaggcgggcgacaccctgccggtcttcgtggtctacggcatcccggaccgcgactgcggg
cagttctccgcgggaggtaccaccgtcgacggctacgagacgtgggtccgcgagatcgcc
accgcgctcgagggcaccgagacccctgtggtcctcgagcccgacgcgctccagctcgcc
gaggagtgcggggacgtcgagcgtcgcctcggcctggtctccacggcaggctcggtgctc
accggggccggggcgaccgtctacctcgacgggggacactccaactggcactccgtccag
gagtccgccgacctgctgcgccgcgccggcgtggccgacgtgcacggcttcgcgaccaac
gtgtccaactacaacgacgacgcctccgagctcgcctacgccgagcgcctgagcgcccag
ctcgacggtgcgccgttcgtcgtggacaccggtcgcaacggcaacgggtccgacggcacc
tggtgcaaccccccgggcgcagccctcggtgcaccgccgctcacgctcgaggccgagggc
ctcgacgccaacctgtgggtgaaacctccgggggagagcgacgggacgtgcgagggcggg
cccgttgccggacaatggtggcctgaccgggcactcagcctcgtcgccggggcccgctga

DBGET integrated database retrieval system