KEGG   Sanguibacter keddieii: Sked_01440Help
Entry
Sked_01440        CDS       T01214                                 

Definition
cellobiohydrolase A
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ske  Sanguibacter keddieii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sked_01440
Enzymes [BR:ske01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Sked_01440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149262..150581
Genome map
AA seq 439 aa AA seqDB search
MARRSSDEPDAPQGPRDPRDPRYVIRVPLEETPEEPEVVPVRGGRTEAPEQRPASDYVIR
AAEPPQQPARTEPPRQPAPVVPQDETGLGDEAASAAPASVRLRKSRRRHPADRPPRIPRR
RLSRPVRWALVLGSVVLLAGVAALVVVRTGLLDDPNPFAGRDLYVDPESEAIKAVDAATD
AATRDAFLTIADQPTAIWLTPEEYPAGEVGPYVAQVVADAEAGDTLPVFVVYGIPDRDCG
QFSAGGTTVDGYETWVREIATALEGTETPVVLEPDALQLAEECGDVERRLGLVSTAGSVL
TGAGATVYLDGGHSNWHSVQESADLLRRAGVADVHGFATNVSNYNDDASELAYAERLSAQ
LDGAPFVVDTGRNGNGSDGTWCNPPGAALGAPPLTLEAEGLDANLWVKPPGESDGTCEGG
PVAGQWWPDRALSLVAGAR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaggagcagcgacgagcccgacgccccgcaggggccccgggacccgcgcgac
ccccgctacgtgatccgcgtcccgctcgaggagacgcccgaggagcccgaggtcgtgccc
gtccgcggcggtcgcaccgaggcccccgagcagcgcccggcgagcgactacgtgatccgg
gcggccgagcctccgcagcagcctgcccgcaccgagcctccgcggcagcccgcacccgtc
gtcccgcaggacgagaccggcctcggagacgaggcggcctcggcggctccggcgtccgtg
cgtctgcggaagagccgtcgacggcacccggcggaccgccctccccgcatcccccgacgg
cggctgtcgcgccccgtccgctgggcgctcgtcctgggctccgtcgtcctcctcgcaggc
gtcgcggcgctcgtcgtcgtgcgcaccggcctgctcgacgaccccaaccccttcgccggg
cgggacctctacgtcgaccccgagtccgaggcgatcaaggccgtcgacgccgcgaccgac
gcggccacgcgcgacgccttcctcaccatcgccgaccagccgaccgccatctggctgacg
cccgaggagtacccggcgggtgaggtcgggccctacgtcgcgcaggtcgtggcggacgcc
gaggcgggcgacaccctgccggtcttcgtggtctacggcatcccggaccgcgactgcggg
cagttctccgcgggaggtaccaccgtcgacggctacgagacgtgggtccgcgagatcgcc
accgcgctcgagggcaccgagacccctgtggtcctcgagcccgacgcgctccagctcgcc
gaggagtgcggggacgtcgagcgtcgcctcggcctggtctccacggcaggctcggtgctc
accggggccggggcgaccgtctacctcgacgggggacactccaactggcactccgtccag
gagtccgccgacctgctgcgccgcgccggcgtggccgacgtgcacggcttcgcgaccaac
gtgtccaactacaacgacgacgcctccgagctcgcctacgccgagcgcctgagcgcccag
ctcgacggtgcgccgttcgtcgtggacaccggtcgcaacggcaacgggtccgacggcacc
tggtgcaaccccccgggcgcagccctcggtgcaccgccgctcacgctcgaggccgagggc
ctcgacgccaacctgtgggtgaaacctccgggggagagcgacgggacgtgcgagggcggg
cccgttgccggacaatggtggcctgaccgggcactcagcctcgtcgccggggcccgctga

DBGET integrated database retrieval system