KEGG   Sanguibacter keddieii: Sked_01850Help
Entry
Sked_01850        CDS       T01214                                 

Definition
alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ske  Sanguibacter keddieii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sked_01850
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sked_01850
   00600 Sphingolipid metabolism
    Sked_01850
Enzymes [BR:ske01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Sked_01850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(193340..194647)
Genome map
AA seq 435 aa AA seqDB search
MVHIAFVGAGSVVFTRQLVSDILRFPELSGAHLSLHDIDPDRLAVAEASTRRVAAQLGAD
AQVTASTDRRTAIAGADFVVNMIQVGGVDATLRDLEIPARHGLLQTIGDTTGVGGIFRAL
RTFPVIEALTTDMRELCPEAWLLNYTNPMAMNVWWASVVAPDIKTVGLCHSVYWTAHDLA
ALVGVPVEETRFRAAGINHQAWLLEWEHEGQSLYPRLAEKIAGDPELQRRVRVEMFRRIG
YYPTETSEHSSEYLPWFLRSPEQIEQYRLTPLEYADISRANLAQLDETRRILAADEDFPL
EEGASEYAPVIIHSIVTGTPREVHVNVPNAGLIDNLPQGAVVEVPATVDASGVHPVPMGA
LPVQCAAINQPYASVGALTVEAARRGDPVLVRQAALVDPNTSSVLTPAQIWALCDELVAA
HGDLLPPALRVQVGS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggttcacatcgcgttcgtcggcgctggcagcgtcgtgttcacccgtcagctcgtgagc
gacatcctccggttccccgagctctccggcgcccacctgtccctccacgacatcgacccc
gaccggctcgccgtcgccgaggcgtcgacgcggcgcgtcgcagcccagctcggtgctgac
gcccaggtcaccgcgtcgaccgaccgccgcacggcgatcgccggcgctgacttcgtcgtc
aacatgatccaggtgggtggggtcgacgcgaccctgcgcgacctcgagatcccggcccgg
cacgggctgctccagaccatcggcgacaccaccggcgtcggcgggatcttccgcgcgctg
cgcaccttccctgtcatcgaggcgctcaccaccgacatgcgcgagctgtgccccgaggcc
tggctgctcaactacaccaacccgatggccatgaacgtctggtgggcctccgtcgtggcc
ccggacatcaagaccgtcggtctgtgccacagcgtctactggaccgcgcacgacctcgcc
gccctcgtcggggtccccgtcgaggagacccggttccgtgccgccggcatcaaccaccag
gcctggctgctcgagtgggagcacgagggccagagcctctacccgcggctcgccgagaag
atcgcaggcgaccccgagctgcagcgccgcgtccgcgtcgagatgttccgccggatcggc
tactaccccaccgagaccagcgagcactcctcggagtacctcccgtggttcctgcgctcc
cccgagcagatcgagcagtaccgcctcaccccgctcgagtacgccgacatcagccgcgcc
aacctcgcccagctcgacgagacccgtcgcatcctcgccgccgacgaggacttccccctc
gaggagggcgccagcgagtacgcgcccgtcatcatccactcgatcgtcacgggcacgccg
cgcgaggtgcacgtcaacgtgccgaacgccgggctgatcgacaacctgccccagggcgcg
gtcgtcgaggtccccgccaccgtcgacgcctcgggggtgcaccccgtcccgatgggtgcg
ctcccggtgcagtgcgcggcgatcaaccagccgtacgcctccgtcggcgccctgaccgtc
gaggcagcgcggcgaggcgaccctgtgctggtgcggcaggcagcgctggtcgacccgaac
acgtcgtcggtgctcacacctgcgcagatctgggccctctgcgacgagctcgtcgccgcc
cacggcgacctcctgccccccgcgctgcgcgtgcaggtcggcagctga

DBGET integrated database retrieval system