KEGG   Sanguibacter keddieii: Sked_01960Help
Entry
Sked_01960        CDS       T01214                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ske  Sanguibacter keddieii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sked_01960
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_01960
   00052 Galactose metabolism
    Sked_01960
   00500 Starch and sucrose metabolism
    Sked_01960
   00520 Amino sugar and nucleotide sugar metabolism
    Sked_01960
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sked_01960
   00524 Butirosin and neomycin biosynthesis
    Sked_01960
Enzymes [BR:ske01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sked_01960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(206249..207217)
Genome map
AA seq 322 aa AA seqDB search
MTQRDALPSLGDGLPVVAIDVGGTTMKVSGVGPTGAMTAPRRVPSPPPGPGSADEVVRIA
TDLVREESERLGVSPAGLGIALPGVVVEDQALGVYSENLEWHDVDFRAAFAQTLDIPVAV
AHDVRAAGAAETRLGAAQGASTALVLAIGTGIATSVQVDGRLHVGRGYAGEIGHAVVEPG
GEPCVCGNRGCLEATASAGAIRRRYERDAGTQVDGAKEVLALAAAGDPVAVAVRDSAFDA
LALGLSHAVTLLVPDVVVIAGGLSEAGDALLVPLAERLERLVRYGPVPPLVRAHLGEDAG
LVGAALAARDALAPTGAAQTSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcgagacgctctccccagcctcggcgacggcctccccgtcgtcgccatcgac
gtcggcggcacgaccatgaaggtctccggcgtcggcccgacgggcgccatgaccgccccg
cgccgtgtccccagcccgccgccgggccccggcagcgccgacgaggtcgtgcgcatcgcc
accgacctcgtccgcgaggagtcggagcggctcggcgtcagcccggccggtctcggcatc
gcgctgcccggtgtcgtcgtcgaggaccaggcgctcggggtgtactccgagaacctcgag
tggcacgacgtcgacttccgggcggccttcgcccagactctcgacatcccggtcgccgtc
gcccacgacgtccgggctgccggcgccgcagagacgcgcctcggtgcggctcagggtgcc
tcgacggccctggtgctcgcgatcggcaccggcatcgccacctcggtccaggtcgacggc
cggctgcacgtcggccgcggctacgccggcgagatcggtcacgccgtcgtcgagcccggc
ggcgagccctgcgtctgcgggaaccgggggtgcctggaggcgacggcctcggccggtgcc
atccgccgccgctacgagcgtgacgccgggacgcaggtcgacggcgcgaaggaggtcctc
gcgctcgccgcagccggcgaccccgtcgcggtcgccgtgcgcgactcggccttcgacgcg
ctcgccctcgggctctcgcacgcggtcaccctgctcgtcccggacgtggtggtcatcgcc
ggcggtctctcggaggccggcgacgcgctgctcgtcccgctcgccgagcggctcgagcgc
ctggtgcggtacggacccgtcccgccgctcgtgcgggcccacctcggcgaggacgccggg
ctggtcggcgcggccctcgcggcccgcgacgccctcgccccgacgggcgctgcgcagacc
tcgcgatga

DBGET integrated database retrieval system