KEGG   Sanguibacter keddieii: Sked_06100Help
Entry
Sked_06100        CDS       T01214                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ske  Sanguibacter keddieii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Sked_06100
Enzymes [BR:ske01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Sked_06100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691361..692047
Genome map
AA seq 228 aa AA seqDB search
MTTVAPANPRTDSRASRAVREEILYCCRESVRVGLNFNTQGNISVRLPGTHDGADAIVIT
PSDVRYDAMSVDDMVVVGLDGTVLEGDLLPSTELPVHLEHYLRRPDVQAIVHTESTFVNV
LGALGRRIDPVLLNMVLYAKGPVETMPFEFSTNADFGRRSAELMGDAVNAVVWGNHGLLA
VGTSLKLAFKVAVAVEENAEVLLRASAAGTPNVLVYDDIDVPEGARLP
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgtggcaccagcgaacccccggacggacagccgcgcgagccgcgcggtgcgg
gaggagatcctctactgctgccgcgagtcggtccgcgtcggcctgaacttcaacacccag
ggcaacatcagcgtgcggctcccgggcacgcacgacggcgccgacgccatcgtcatcacg
ccctccgacgtccggtacgacgcgatgagcgtcgacgacatggtggtcgtggggctcgac
ggcaccgtcctcgagggagacctgctcccgtcgacggagctcccggtgcacctcgagcac
tacctgcgccgccccgacgtgcaggcgatcgtccacacggagtccaccttcgtcaacgtc
ctcggtgcgctcggccggaggatcgaccccgtgctgctcaacatggtgctctacgccaag
gggccggtcgagaccatgcccttcgagttctcgaccaacgccgacttcgggcgccgcagc
gccgagctcatgggcgacgcggtgaacgccgtcgtgtggggcaaccacgggctgctggcg
gtcgggacctccctcaagctcgcgttcaaggtggccgtggccgtcgaggagaacgccgag
gtcctgctccgggcgagcgctgcggggacgccgaacgtgctcgtctacgacgacatcgac
gtgccggagggggctcgcctgccctga

DBGET integrated database retrieval system