KEGG   Sanguibacter keddieii: Sked_06190Help
Entry
Sked_06190        CDS       T01214                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ske  Sanguibacter keddieii
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ske00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ske00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
699909..701090
Genome map
AA seq 393 aa AA seqDB search
MAHASGINYSFGLWTVGWNAQDQFGSASRPHLDPARAVRKLAELGAWGFTFHDDDVVPFG
SDDATRDRLLGEVKTAAEESGMTIEMVTTNLFGHPVFKDGGFTSNDRSVRRFALRKVLRN
IDLTAELGAKTFVMWGGREGSEYDGAKDLHAALERYREGIDLVAGYIKEKGYDMRIALEP
KPNEPRGDIFLPTIGHALGFIAQLEHGDIVGLNPETGHEQMAGLNYTHGLAQALWSDKLF
HIDLNGQRSIKFDQDLVFGHGDLLSAFFTVDLVENGFPGSPDAPRYTGPRHFDYKPSRTE
VEAGVWDSASANMEMYEMLAKKSAAYRADPEVQEAFTTAGIFELATPTLNPGETVDELLA
DRSAFEDFDPEAAAERDFGFVRLNQLALRHLIG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgcatcaggcatcaactactccttcggcctctggaccgtgggctggaacgcc
caggaccagttcggctccgcgtcccgcccgcacctcgacccggcgcgcgcggtccgcaag
ctcgccgagctcggtgcctggggcttcaccttccacgacgacgacgtcgtccccttcggc
tcggacgacgccacccgcgaccgcctgctcggcgaggtgaagacggccgccgaggagagt
ggcatgaccatcgagatggtcacgacgaacctcttcgggcaccccgtgttcaaggacggc
ggtttcacgtcgaacgaccgctccgtgcgtcgcttcgcgctccgcaaggtgctccgcaac
atcgacctcaccgccgagctcggcgccaagaccttcgtcatgtggggcggccgcgaggga
tccgagtacgacggcgccaaggacctgcacgccgcgctcgagcgctaccgcgagggcatc
gacctcgtcgccgggtacatcaaggagaagggctacgacatgcgcatcgcgctcgagccc
aagcccaacgagccccgcggagacatcttcctcccgaccatcggccacgctctcgggttc
atcgcccagctcgagcacggcgacatcgtcggcctcaacccggagaccggccacgagcag
atggccggcctcaactacacgcacgggctcgcccaggcgctgtggtcggacaagctcttc
cacatcgacctcaacggtcagcgctcgatcaagttcgaccaggacctcgtcttcggtcac
ggagacctgctgtcggccttcttcacggtggacctcgtcgagaacggcttcccggggtcg
cccgacgctcctcgctacacgggtccgcgccacttcgactacaagccctcgcgcaccgag
gtcgaggcgggcgtctgggactctgcgtcggccaacatggagatgtacgagatgctcgcc
aagaagtcggctgcgtaccgcgccgaccccgaggtgcaggaggccttcacgaccgccggc
atcttcgagctcgccacgccgaccctcaaccccggcgagaccgtcgacgagctcctcgcc
gaccgctcggccttcgaggacttcgaccccgaggccgccgctgagcgcgacttcggcttc
gtgcgcctcaaccagctggccctgcgccacctcatcggctga

DBGET integrated database retrieval system