KEGG   Sanguibacter keddieii: Sked_06550Help
Entry
Sked_06550        CDS       T01214                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ske  Sanguibacter keddieii
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ske00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(746908..748971)
Genome map
AA seq 687 aa AA seqDB search
MASRWIRWPEPLAGAAPTPRGPLAYGGDYNPEQWPREVWLEDARLMQEAGVNLVSVAIFS
WARLQPAPDQWDFEWLDDVLDIMHSHGIAVDLATATASTPAWLTTLHPEILPVDVDGHTL
YHGSRQSWSPSSPVYREYSLALVEKMAERYGDHPALAMWHVSNELGCHNVLDYSDVAAVA
FRGWLEARYTTLDELNRAWGTDFWAQRYTAWDQILPPRRSTAFVNPTQQLDFGRFSSYQL
REQLRAEREVLTRITPDVPVTTNFMVMGDTKAMDYTSWAGDVDLVSNDHYITSADPVSHI
ELSFSADLTHGIAGGEPWMLMEHSTSAVNWQHVNLQKRPGQMRRNSLAHVAHGADAVCFF
QWRQSQAGAEKFHSAMVPHAGTDSALWRGVVSLGADLVSLGEVAGSTVQAQTAVLFDYES
WWATEIDSHPNNEFQYRRRVLSWYRSLWEKQVGTAVVPAHADLTGYKLVVVPHLYLADES
LVARLTSFAEAGGTVVVTYFSGIANQDDHIHLGGYPGAFRDLLGVRVEEFAPVLPGDTIH
LDGDVVGGSSAEASGWSEPVGLVDAEARATYVDGPSVGWPAISRATRGAGAAWYVTTDLS
DAARGELVDALLAEAQVTAIAQADAGVELVVRADQAGTEFLFAINHTDETASVEASGTDL
LTGTVHEGSVKVEAGGVAVLRRTAQQA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccgttggatccgctggcccgagccgctcgccggcgccgcccccaccccgcgc
ggcccgctcgcctacggtggcgactacaaccccgagcagtggccccgcgaggtctggctc
gaggacgcccgcctcatgcaggaggccggggtcaacctggtctcggtcgcgatcttctcg
tgggcacgtctgcagccggccccggaccagtgggacttcgagtggctcgacgacgtcctc
gacatcatgcacagccacgggatcgccgtggacctcgccacggcgaccgcctccacgccg
gcctggctcaccacgctgcacccggagatcctgcccgtcgacgtcgacggccacacgctc
taccacgggtcgcgccagtcctggagcccaagctcgccggtgtaccgcgagtactcgctg
gccctcgtcgagaagatggccgagcgctacggcgaccacccggcgctggccatgtggcac
gtgtccaacgagctcggctgccacaacgtgctcgactactccgacgtcgcagccgtcgcg
ttccgcggctggctcgaggcccgctacaccaccctcgacgagctcaaccgtgcgtggggc
accgacttctgggcgcagcgctacaccgcctgggaccagatcctcccgccgcgccgctcg
accgccttcgtcaacccgacgcagcagctcgacttcggacgcttctcctcctaccagctg
cgcgagcagctgcgcgccgagcgcgaggtgctgacccgcatcacgcccgacgtccccgtc
accaccaacttcatggtcatgggcgacaccaaggcgatggactacacgtcgtgggccggt
gacgtcgacctcgtgtcgaacgaccactacatcacctcggccgaccccgtctcgcacatc
gagctgtcgttctccgccgacctcacgcacggcatcgccggcggcgagccctggatgctc
atggagcactccacctccgccgtgaactggcagcacgtcaacctgcagaagcgcccgggc
cagatgcgccgcaactcgctcgcgcacgtcgcgcacggcgccgacgcggtctgcttcttc
cagtggcgccagtcccaggccggggccgagaagttccactccgcgatggtcccccacgcc
ggcaccgactcggcgctgtggcgcggcgtcgtctcgctcggcgcagacctcgtgtccctc
ggcgaggtcgccggctcgaccgtccaggcgcagaccgcggtgctgttcgactacgagtcc
tggtgggccaccgagatcgactcgcaccccaacaacgagttccagtaccgccgccgcgtg
ctctcctggtaccgctcgctgtgggagaagcaggtcggcaccgccgtcgtgcccgcgcac
gccgacctcacgggctacaagctggtcgtcgtgccgcacctgtacctcgcagacgagtcg
ctcgtggcccgcctgacctccttcgcggaggccggcggcaccgtcgtcgtcacgtacttc
tctggcatcgcgaaccaggacgaccacatccacctcggcgggtaccccggcgcgttccgc
gacctgctcggcgtccgcgtcgaggagttcgcccccgtgctccccggcgacacgatccac
ctcgacggcgacgtcgtcggcgggtcgtccgccgaggcgtccggctggtccgagcccgtc
ggcctcgtcgacgccgaggcccgcgccacgtacgtggacggcccgagcgtgggctggccc
gcgatctcgcgtgctacccgcggcgccggtgcggcctggtacgtcacgaccgacctgtcc
gacgcggcacgcggcgagctcgtcgacgcgctgctcgccgaggctcaggtcacggcgatc
gcccaggccgacgcgggcgtcgagctcgtggtccgcgccgaccaggccggcaccgagttc
ctcttcgcgatcaaccacaccgacgagaccgcctcggtcgaggcctcgggcacggacctc
ctcacggggaccgtccacgagggctcggtcaaggtcgaggccggcggcgtcgcagtcctg
cgccgcaccgcgcagcaggcctga

DBGET integrated database retrieval system