KEGG   Sanguibacter keddieii: Sked_06800Help
Entry
Sked_06800        CDS       T01214                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ske  Sanguibacter keddieii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ske00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(778786..780303)
Genome map
AA seq 505 aa AA seqDB search
MTEQYVLAIDQGTTSSRAIVFKHNGTIHSSGQLEHDQIFPRAGWVEHNPEQIWNNVREAV
GLALTRGNLTHEDIAAVGITNQRETAVVWDRNTGKPVYNAIVWQDTRTQKIVDELGGEEG
ADKYKAIVGLPLATYFSGPKVKWILDNVDGAREAAERGDLMFGNTDSWVLWNMTGGTEGG
VHITDVTNASRTMLMNIDSLTWNEDIAKDMGIPLSMLPEIRSSSEVYGTGRARGMVPGVP
IAGILGDQQAATFGQACFEKGTAKNTYGTGNFMLLNTGTEPVHSKNGLLTTVCYKIGDAP
QVYALEGSIAVTGSLIQWMRDNLGMFEEAKDVEYYASKVDDNGGAYFVPAFSGLFAPYWR
PDARGALVGLTRFVNKNHIARAALEATAFQTREVLDAMNADSGVDLTELKVDGGMVANEL
LMQFQADILDVDVVRPQVAETTALGAAYAAGIAVGFWNGEQDVIDNWAEDKRWSSTMETS
ERDRQYRLWKKAVSKTLDWVDEDVV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcagtacgttctcgccatcgaccagggcaccacgagctcgcgtgccatcgtc
ttcaagcacaacgggaccatccactcctccggccagctcgagcacgaccagatcttcccc
cgtgccggctgggtcgagcacaaccctgagcagatctggaacaacgtccgcgaggctgtc
ggcctggccctgacgcgcgggaacctcacgcacgaggacatcgccgccgtcggcatcacc
aaccagcgcgagaccgcggtcgtgtgggaccgcaacaccggcaagccggtctacaacgcg
atcgtctggcaggacacccgcacgcagaagatcgtcgacgagctcggcggtgaggagggc
gcggacaagtacaaggcgatcgtcggcctcccgctcgcgacctacttctcgggcccgaag
gtcaagtggatcctcgacaacgtcgacggagcccgcgaggcagccgagcgcggcgacctc
atgttcggcaacaccgactcctgggtgctgtggaacatgaccggcgggaccgagggcggc
gtgcacatcaccgacgtcaccaacgcctcgcgcaccatgctcatgaacatcgactcgctc
acctggaacgaggacatcgcgaaggacatgggcatcccgctgtccatgctccccgagatc
cgctcctcgtccgaggtctacggcaccggccgcgcgcgcggcatggtccccggcgtcccg
atcgccggcatcctcggcgaccagcaggcggccaccttcggccaggcctgcttcgagaag
ggcaccgcgaagaacacgtacggcaccggcaacttcatgctgctcaacacgggcaccgag
cccgtgcacagcaagaacggcctgctgacgacggtctgctacaagatcggcgacgccccg
caggtgtacgcgctcgagggctcgatcgccgtgaccggctcgctcatccagtggatgcgc
gacaacctcggcatgttcgaggaggccaaggacgtcgagtactacgcgagcaaggtcgac
gacaacggcggcgcgtacttcgtgcccgcgttctccggtctgttcgcaccgtactggcgc
ccggacgcacgcggtgcgctcgtgggcctcacgcggttcgtcaacaagaaccacatcgcc
cgtgcggccctcgaggccaccgcgttccagacccgcgaggtcctcgacgcgatgaacgcc
gactccggcgtggacctcaccgagctcaaggtcgacggcggcatggtcgccaacgagctg
ctcatgcagttccaggccgacatcctcgacgtcgacgtggtccgcccgcaggtcgccgag
accaccgccctcggtgccgcctacgcggccggcatcgcggtgggcttctggaacggcgag
caggacgtcatcgacaactgggccgaggacaagcgctggtcgtccacgatggagacctcc
gagcgcgaccgccagtaccgcctctggaagaaggccgtctcgaagaccctcgactgggtc
gacgaggacgtcgtctga

DBGET integrated database retrieval system