KEGG   Sanguibacter keddieii: Sked_09620Help
Entry
Sked_09620        CDS       T01214                                 

Definition
alcohol dehydrogenase, class IV (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ske  Sanguibacter keddieii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sked_09620
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_09620
   00620 Pyruvate metabolism
    Sked_09620
   00650 Butanoate metabolism
    Sked_09620
  Lipid metabolism
   00071 Fatty acid degradation
    Sked_09620
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sked_09620
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sked_09620
   00626 Naphthalene degradation
    Sked_09620
Enzymes [BR:ske01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sked_09620
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sked_09620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1111973..1114786)
Genome map
AA seq 937 aa AA seqDB search
MTLTDAPTTVAAEIDALVTAGNAALAEYASFTQEQIDHIVKKASVAALNQHGELAVHAVR
ETGRGVFEDKAVKNIFACEHVTNSMQNLKTVGIIGRDELTGITEIAEPVGVICGVTPVTN
PTSTAIFKSLIALKTRNPIIFGFHPSAQQSSVAAARVVRDAAVAAGAPADCIQWVEHPSL
EATNLLMNHPGVALILATGGNAMVRAAYSCGKPALGVGAGNVPAFIERSAKLKRAVNDVV
LSKAFDNGMICASEQAVILDAPIYDEAMAEFATLHAYTVNAAEKAMLEEFIFGVQADGTN
CGEAKLNPTVVGQSPEWIASKAGFTVPEGTSIILAEVSEVGPSEPLTREKLCPVLAVLRA
DGAEEGIRLSEQMVEFDGLGHSGSIHSEDQAIIEEFGSRVKAVRIITNAPSSLGGIGDIY
NAFIPSLTLGCGSYGHNSVSNNVSAINLVNIKRIGRRNNNLQWFKVPAKTYFEPNAIRYL
ADMRGISRVTIVTDSTMTRLGFVDKILDVLNRRGDRVALQIIDDILPEPTVDSVTAGAEL
MRAFHPDTIIALGGGSPMDAAKVMWLLYEHPEIEFADMKEKFFDVRKRAFKFPDLGEKAS
LVCIPTTSGTGSEMTPFAVITDPVTGKKYPLADYALTPTVAIVDPALTAMMPGFLAADSG
FDALTHATEAFVSVYANDFTDGLCLHAIKLIFENIEASVNGAPGSTDQTVVKAREKMHNA
ATIAGMAFGNAFLGIVHAMAHVTGSAFHLIHGRTNATYLPHVIRYNGTVPTKLTSWPKYE
HYVAPERFQEIAKHLGLPASTPAEGVESYAKAVEALRDKVGIAPSFQAQGVAEEDFIGSL
DMLAMGAYEDQCAPANPRMPMLEDMKTIMEAAYYGTSFEAVRASRRAAVEPTVPAEATVP
AEALVSVPAETTPGTTPDDAAETSAEPAAAPKKGRRR
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgactctcaccgacgcaccgaccacagtcgccgcagagatcgacgcactcgtgaccgca
ggcaacgccgcgctcgccgagtacgcgagcttcacgcaggagcagatcgaccacatcgtc
aagaaggcgtcggtcgctgccctcaaccagcacggcgagctcgcggtgcacgccgtccgc
gagaccggccgcggggtgttcgaggacaaggccgtgaagaacatcttcgcgtgcgagcac
gtcaccaactcgatgcagaacctcaagaccgtcggcatcatcggccgcgacgagctcacg
ggaatcaccgagatcgccgagcccgtcggcgtgatctgcggcgtcaccccggtgaccaac
ccgacctcgacggcgatcttcaagtcgctcatcgcgctcaagacccgcaacccgatcatc
ttcggcttccacccctcggcccagcagtcctcggtcgccgcggcccgtgtcgtccgtgac
gccgccgtcgcggcaggcgcaccggccgactgcatccagtgggtcgagcacccgtcgctc
gaggccaccaacctcctcatgaaccacccgggcgtcgcgctcatcctcgcgaccggtggc
aacgcgatggtccgggccgcgtactcctgcggcaagcccgccctcggggtcggcgccggc
aacgtccccgccttcatcgagcgcagcgccaagctcaagcgcgccgtcaacgacgtggtc
ctctcgaaggccttcgacaacggcatgatctgcgcctccgagcaggccgtcatcctcgac
gccccgatctacgacgaggccatggccgagttcgcgaccctgcacgcctacaccgtgaac
gccgccgagaaggcgatgctcgaggagttcatcttcggcgtccaggccgacggcaccaac
tgcggcgaggccaagctcaacccgacggtcgtcggccagagccccgagtggatcgcctcc
aaggcgggcttcacggtccccgagggcacgtcgatcatcctcgccgaggtctccgaggtc
gggccgtccgagcccctcacccgcgagaagctctgccccgtgctcgccgtgctgcgcgcc
gacggcgccgaggagggcatccgcctctccgagcagatggtggagttcgacggcctcggc
cactcgggctcgatccactccgaggaccaggcgatcatcgaggagttcggctcccgcgtg
aaggccgtccgcatcatcaccaacgcgcccagctcgctcggcggcatcggcgacatctac
aacgccttcatcccctcgctgaccctcggctgcggctcctacggccacaactcggtctcc
aacaacgtgtcggccatcaacctcgtcaacatcaagcgcatcggccggaggaacaacaac
ttgcagtggttcaaggtccccgccaagacgtacttcgagccgaacgccatccgctacctc
gccgacatgcggggcatcagccgggtcaccatcgtcaccgactcgaccatgacccgcctc
ggcttcgtcgacaagatcctcgacgtgctcaaccgccgcggcgaccgcgtcgccctgcag
atcatcgacgacatcctccccgagccgaccgtcgactcggtcaccgcaggtgccgagctc
atgcgggccttccaccccgacacgatcatcgccctcggtggcggatcgcccatggacgcc
gcgaaggtcatgtggctcctgtacgagcaccccgagatcgagttcgcggacatgaaggag
aagttcttcgacgtccgcaagcgcgccttcaagttccccgacctcggcgagaaggccagc
ctcgtctgcatcccgaccacctcgggcaccggctccgagatgacccccttcgcggtcatc
accgacccggtcacgggcaagaagtacccgctcgccgactacgcgctcaccccgaccgtc
gccatcgtcgaccccgcgctgaccgcgatgatgcccggcttcctcgctgccgactccggc
ttcgacgccctgacccacgcgaccgaggccttcgtctccgtctacgcgaacgacttcacc
gacggcctctgcctgcacgccatcaagctgatcttcgagaacatcgaggcctcggtcaac
ggcgcaccgggcagcaccgaccagacggtcgtcaaggcccgcgagaagatgcacaacgcc
gcgaccatcgccggcatggccttcggcaacgcgttcctcgggatcgtgcacgcgatggcg
cacgtcaccgggtcggccttccacctcatccacggccgcaccaacgcgacctacctgccg
cacgtcatccgctacaacggcaccgtgcccacgaagctcaccagctggcccaagtacgag
cactacgtcgcacccgagcgcttccaggagatcgccaagcacctcgggctcccggcgtcg
accccggccgagggtgtcgagtcctacgccaaggccgtcgaggcgctccgcgacaaggtc
ggcatcgccccgtccttccaggcccagggcgtggccgaggaagacttcatcgggagcctg
gacatgctcgccatgggtgcctacgaggaccagtgcgcaccggccaacccccgcatgccg
atgctcgaggacatgaagaccatcatggaggccgcgtactacggcacctccttcgaggcc
gtccgggccagccgacgggccgccgtcgagccgaccgtcccggccgaggccaccgtcccg
gccgaggccctcgtcagcgtccccgcggagaccacgccgggcaccaccccggacgacgca
gccgagacctccgcggagcccgcagcggccccgaagaagggccgccgccgctag

DBGET integrated database retrieval system