KEGG   Sanguibacter keddieii: Sked_09880Help
Entry
Sked_09880        CDS       T01214                                 

Definition
(RefSeq) L-threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ske  Sanguibacter keddieii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sked_09880
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sked_09880
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sked_09880
Enzymes [BR:ske01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sked_09880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1143323..1144390
Genome map
AA seq 355 aa AA seqDB search
MAHVWQGIIREYADLLPEHLTTHVVTLGEGGTPLVPAPALSALTGAEVFLKVEGMNPTGS
FKDRGMTTAISAAAHKGAQAVVCASTGNTSASAAAYATAAGMTCAVLVPDGKIAMGKLSQ
AIAHGAKLLQVDGNFDDCLVAARKLAEAYPVELVNSVNPDRIQGQKTGSFEVVDVLGDAP
TIHALPVGNAGNITAYWKGYVEYLEAGISTHLPQMWGFQAAGAAPIVAGHPITEPETIAT
AIRIGNPASWEQAVEARDTSKGVIESVTDEQILLAHRILSAEVGVFVEPASAAGVAGIIS
RAERGLVPAGARIVVTVTGHGLKDPQWALRTADGSEIVPQRVTADVVSIADALGL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgtgtggcaaggcatcatccgcgagtacgccgacctgctgcccgagcacctc
accacgcacgtcgtcaccctcggcgagggcggcacgcccctggtccccgccccggcgctc
tccgcgctgaccggtgcggaggtcttcctcaaggtcgagggcatgaacccgaccgggtcc
ttcaaggaccgcggcatgacgacggccatctccgcggccgcgcacaagggtgcccaggcc
gtggtgtgcgcctcgacgggcaacacctccgcctcggccgccgcctacgcgaccgccgcg
ggcatgacctgcgcggtcctcgtgccggacggcaagatcgccatgggcaagctgagccag
gccatcgcgcacggggcgaagctcctccaggtggacggcaacttcgacgactgcctcgtg
gccgcccgcaagctcgccgaggcgtacccggtcgagctcgtgaactccgtcaaccccgac
cgcatccagggccagaagacgggctccttcgaggtcgtcgacgtgctcggcgacgcaccg
accatccacgcgctgcccgtcggcaacgccggcaacatcaccgcgtactggaagggctac
gtcgagtacctcgaggcggggatctcgacgcacctgccgcagatgtggggcttccaggcg
gcaggtgccgccccgatcgtcgccgggcacccgatcaccgagcccgagaccatcgccacg
gccatccgcatcggcaaccccgcgtcgtgggagcaggccgtcgaggcccgcgacacgtcg
aagggcgtcatcgagtcggtcaccgacgagcagatcctcctcgcgcaccgcatcctctcc
gccgaggtcggcgtcttcgtcgagcctgcgtcggcggccggcgtcgccgggatcatctcc
cgtgccgagcgcgggctggtgcccgccggtgcccggatcgtcgtgaccgtcaccgggcac
ggcctcaaggacccgcagtgggcgctgcgcaccgcggacggctcggagatcgtgccgcag
cgcgtgaccgccgacgtggtctcgatcgccgacgccctcggtctctga

DBGET integrated database retrieval system