KEGG   Sanguibacter keddieii: Sked_09880Help
Entry
Sked_09880        CDS       T01214                                 

Definition
L-threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ske  Sanguibacter keddieii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sked_09880
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sked_09880
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sked_09880
Enzymes [BR:ske01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sked_09880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1143323..1144390
Genome map
AA seq 355 aa AA seqDB search
MAHVWQGIIREYADLLPEHLTTHVVTLGEGGTPLVPAPALSALTGAEVFLKVEGMNPTGS
FKDRGMTTAISAAAHKGAQAVVCASTGNTSASAAAYATAAGMTCAVLVPDGKIAMGKLSQ
AIAHGAKLLQVDGNFDDCLVAARKLAEAYPVELVNSVNPDRIQGQKTGSFEVVDVLGDAP
TIHALPVGNAGNITAYWKGYVEYLEAGISTHLPQMWGFQAAGAAPIVAGHPITEPETIAT
AIRIGNPASWEQAVEARDTSKGVIESVTDEQILLAHRILSAEVGVFVEPASAAGVAGIIS
RAERGLVPAGARIVVTVTGHGLKDPQWALRTADGSEIVPQRVTADVVSIADALGL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgtgtggcaaggcatcatccgcgagtacgccgacctgctgcccgagcacctc
accacgcacgtcgtcaccctcggcgagggcggcacgcccctggtccccgccccggcgctc
tccgcgctgaccggtgcggaggtcttcctcaaggtcgagggcatgaacccgaccgggtcc
ttcaaggaccgcggcatgacgacggccatctccgcggccgcgcacaagggtgcccaggcc
gtggtgtgcgcctcgacgggcaacacctccgcctcggccgccgcctacgcgaccgccgcg
ggcatgacctgcgcggtcctcgtgccggacggcaagatcgccatgggcaagctgagccag
gccatcgcgcacggggcgaagctcctccaggtggacggcaacttcgacgactgcctcgtg
gccgcccgcaagctcgccgaggcgtacccggtcgagctcgtgaactccgtcaaccccgac
cgcatccagggccagaagacgggctccttcgaggtcgtcgacgtgctcggcgacgcaccg
accatccacgcgctgcccgtcggcaacgccggcaacatcaccgcgtactggaagggctac
gtcgagtacctcgaggcggggatctcgacgcacctgccgcagatgtggggcttccaggcg
gcaggtgccgccccgatcgtcgccgggcacccgatcaccgagcccgagaccatcgccacg
gccatccgcatcggcaaccccgcgtcgtgggagcaggccgtcgaggcccgcgacacgtcg
aagggcgtcatcgagtcggtcaccgacgagcagatcctcctcgcgcaccgcatcctctcc
gccgaggtcggcgtcttcgtcgagcctgcgtcggcggccggcgtcgccgggatcatctcc
cgtgccgagcgcgggctggtgcccgccggtgcccggatcgtcgtgaccgtcaccgggcac
ggcctcaaggacccgcagtgggcgctgcgcaccgcggacggctcggagatcgtgccgcag
cgcgtgaccgccgacgtggtctcgatcgccgacgccctcggtctctga

DBGET integrated database retrieval system