KEGG   Sanguibacter keddieii: Sked_11120Help
Entry
Sked_11120        CDS       T01214                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ske  Sanguibacter keddieii
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sked_11120
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sked_11120
Enzymes [BR:ske01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Sked_11120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1290176..1291492
Genome map
AA seq 438 aa AA seqDB search
MTDLLSVDGGNPLNGTITVRGAKNFVSKAMVASLLGEGPSELRNVPEIRDVKVVSGLLEL
HGVSVDYDVPAGVLRLDPSNVESAHVADIDAHAGSSRIPILFCGPLLHRLGEAFIPDLGG
CRIGDRPINYHLDILRQFGAQVDKREQGIHLTAPNGLRGTKITLPYPSVGATEQLLLTAV
RAEGITELSNAAIEPEIMDLINVLQKMGAIISVDTDRVIRIEGVSKLSGYRHTALGDRIE
ASSWASAALATQGDIFVKGATQPEMTAFLNTFRKVGGEFEVEDDGIRFFHPGGELRSIVL
ETDVHPGFMTDWQQPLVVALTQAKGLSIVHETVYENRFGFTDALRGMGANIQVYKECLGG
RPCRFGQRNFYHSAVISGPTPLAAADIEVPDLRGGFSHLIAALAAKGTSKVRGITLIDRG
YERFTEKLEALGAEFSRS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacagatctgctctccgtcgacggcggcaacccgctgaacggaaccatcaccgtccgc
ggtgcgaagaacttcgtctccaaggccatggtcgcctcgctcctcggcgaaggccccagc
gagctgcgcaacgtccccgagatccgcgacgtcaaggttgtctccggtctcctcgagctc
cacggcgtctcggtcgactacgacgtcccggccggtgtgctccggctcgacccgagcaac
gtcgagtccgcccacgtggccgacatcgacgcgcacgccggctcgagccgcatcccgatc
ctcttctgcggaccgctgctgcaccgcctcggtgaggccttcatccccgacctcggcggc
tgccgcatcggcgaccggccgatcaactaccacctcgacatcctgcgccagttcggcgcc
caggtggacaagcgcgagcagggcatccacctcaccgccccgaacggcctgcgcggcacc
aagatcacgctgccgtacccgagcgtcggcgcgaccgagcagctgctgctcaccgccgtg
cgcgccgagggcatcaccgagctgtccaacgcggccatcgagcccgagatcatggacctc
atcaacgtcttgcagaagatgggcgcgatcatctcggtcgacaccgaccgcgtgatccgg
atcgagggcgtctccaagctgtccgggtaccgccacacggcgctcggcgaccgcatcgag
gcctcctcgtgggcctccgccgcgctcgccacccagggcgacatcttcgtcaagggcgcg
acgcagccggagatgaccgcgttcctcaacaccttccgcaaggtcggcggcgagttcgag
gtcgaggacgacggcatccggttcttccaccccggtggcgagctccggtcgatcgtcctc
gagaccgacgtgcaccccggcttcatgacggactggcagcagccgctcgtcgtggcgctc
acccaggccaagggcctgtcgatcgtccacgagaccgtctacgagaaccgcttcgggttc
accgacgcgctgcgcggcatgggtgccaacatccaggtctacaaggagtgcctcggcgga
cggccctgccgtttcggccagcggaacttctaccactccgccgtgatctccggcccgacg
ccgctcgccgcggccgacatcgaggtcccggacctgcgcggaggcttcagccacctcatc
gcggccctcgccgcgaagggcacctcgaaggtccgcggcatcacgctcatcgaccgcggc
tacgagcgcttcaccgagaagctcgaggcgctcggcgcggagttctcgcgcagctga

DBGET integrated database retrieval system