KEGG   Sanguibacter keddieii: Sked_11300Help
Entry
Sked_11300        CDS       T01214                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase/Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ske  Sanguibacter keddieii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ske03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1307207..1308136
Genome map
AA seq 309 aa AA seqDB search
MPELPEVETVRDGLARHVLGARVDCVEVRRDYSVRRHEGGPVDFAARLSGHRLVEAARRG
KYLWLTLDEPGLALLGHLGMSGQLLVRSGDTLTAESSHLRVRLHLTAADGTPLALDFVDQ
RTFGHLSVTELVATPDGLPGGLGTDEPLVPEPVSHIARDLLDPAVAEGTAGRTALVDRVR
RRRTGIKRALLDQTVVSGIGNIYADEALWRASTHYARGTAGMSRAQVAAVLAAAEQVMRE
ALSQGGTSFDALYVNVNGASGYFDRSLAAYGQAGKPCRRCGATIRRDEFMNRSSFSCPVC
QPRPRNASR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagctccccgaggtcgagacggtccgcgacggcctcgcccggcacgtgctgggc
gcgcgcgtggactgcgtcgaggtccgccgcgactacagcgtccgtcggcacgagggcgga
ccggtcgacttcgccgcgcgcctctcgggccaccgcctggtcgaggccgcacgacgcggc
aagtacctctggctgactctcgacgagcccggcctcgcgctcctcgggcacctgggcatg
agcggccagctcctcgtgcgctcgggggacaccctcaccgccgagtcgagccacctgcgg
gtccggctccacctcaccgcagcagacggcacacccctcgccctcgacttcgtcgaccag
cggaccttcggtcacctcagcgtcaccgagctcgtcgcgacccccgacggtctgccgggc
ggcctcggcaccgacgagccgctcgtccccgagcccgtctcccacatcgcgcgcgacctc
ctcgacccggccgtcgccgaggggaccgccggacggacagccctcgtcgaccgggtccgc
cgccggcgcaccgggatcaagcgggcgctgctcgaccagaccgtcgtctcgggcatcggc
aacatctacgcggacgaggccctgtggcgggcgtccacgcactacgcccgggggaccgcc
gggatgtcccgcgcccaggtcgccgcggtgctggccgccgccgagcaggtgatgcgcgag
gcgctcagccagggcgggaccagcttcgacgcgctctacgtcaacgtcaacggtgcgtcg
ggctacttcgaccggtctctcgccgcctacggccaggccggcaaaccctgccgcaggtgc
ggtgcgacgatccggcgcgacgagttcatgaaccgttcgtcgttcagctgcccggtatgc
cagccgcgccctcggaacgcgtcgcggtag

DBGET integrated database retrieval system