KEGG   Sanguibacter keddieii: Sked_14320Help
Entry
Sked_14320        CDS       T01214                                 

Definition
beta-galactosidase/beta-glucuronidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ske  Sanguibacter keddieii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sked_14320
  Lipid metabolism
   00600 Sphingolipid metabolism
    Sked_14320
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sked_14320
Enzymes [BR:ske01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Sked_14320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1611715..1614693
Genome map
AA seq 992 aa AA seqDB search
MPRHDTVSLPTGTVPARFRPPTGASDAASVSLDGPWRFRLFPSADTGADPADRGDEWDTI
EVPGHWQLAGAPDTWPYGTPAYSNVLYPFPVEPPFVPDANPTGEYRRTFEVPAGWAADGR
AYLRFEGVDSWFEVSVNGAVVATSHGSRLATEIDVTDVVVPGENLLSVRVTQWSALSYVE
DQDQWWLSGIFRSVTLEHRPEASVAHATVVADYDHTTGTGSLTVEVEGSAEARVTVPELG
IDVAAGETATAQVEPWSAERPRLYDVTVTTPGETVTLRAGFRTVSIEDGVFLVNGAPVKL
RGVNRHEFDPLRGRSVTPERMLEDVLLMKRHHVNAVRTSHYPPHPHFLDLCDEHGLYVVD
ENDLETHGFIDGGWVGNPTDDPAWEDVLVDRVTRTVRRDAHHPSIVLWSLGNEAGSGCNV
AAMTAAVRALDPTRPVHYEGDWSSDDVDVYSRMYATSEETELIGQGVEAPLARAEADARR
RQMPFLQCEYAHAMGNGPGGLSDYDAIFDRYPRLMGGFIWEWIDHGLTRRTDDGTEFAAY
GGDFGEDFHDGTFIADGLVLPDRTPAPSLVEMAAVFAPVRLDPTADGTTLLVRNRYAFRD
TSHLTFEWTLHHGDDVLATDTLDDLVLAPGEERSVAPPAGLDLPSPDHTPTWWTLRAVQH
EADHLDAPWFDDAAGSFVVSSGQLALTPAVSLPEATGRAQQTSDGFTVGHARFDARGTLL
ELHGRPVAELRVDAWRAPTDNDRREGSWVDLSDESVWKESGLHLLAERKVSAEITDGALV
VTARTAGPRTRNGFRTVYTWRPVADGSDDVDLHVAITPEGRWGQSIARLGVLLVLDEPGA
EDVAVRWHGLGPEESYSDSRKAAVGGAYEHTVRSLQTRYTHPQENGARRGVTHAELTFAD
GSELTLDAGPSSVGGRSTAGLELSLRPWSDTALDQAAHPHDLVPDGKLWLHLDARQHGLG
SAACGPGVLSNARLTAAPAEVSVRLASQPVGR
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgtcacgacaccgtcagcctgccgaccgggaccgttcccgcgcggttccgcccg
ccgacaggcgcctccgacgccgcgtcggtgagcctcgacggcccgtggcgcttccggctg
ttcccgtcggccgacaccggtgccgaccctgcagaccgcggcgacgagtgggacaccatc
gaggtccccgggcactggcagctcgccggtgcacccgacacctggccctacggcaccccg
gcctacagcaacgtgctctaccccttcccggtcgagccgcccttcgtgcccgacgcgaac
ccgacgggggagtaccgccggaccttcgaggtcccggccgggtgggccgctgacggtcgc
gcctacctgcgcttcgagggcgtggactcgtggttcgaggtgtcggtcaacggcgccgtc
gtcgccacctcgcacggctcccgcctggcgacagagatcgacgtcaccgacgtcgtcgtc
ccgggcgagaacctgctctcggtccgcgtgacccagtggtcggcgctcagctacgtcgag
gaccaggaccagtggtggctgtcgggcatcttccgcagcgtgaccctcgagcaccggccg
gaggcgagcgtcgcgcacgcgaccgtcgtcgcggactacgaccacaccacggggaccggc
tcgctcaccgtcgaggtcgagggatctgccgaggctcgcgtcaccgtccccgagctcggc
atcgacgtcgcggccggcgagaccgcgactgcgcaggtcgagccgtggagcgccgagcgg
ccgcgtctctacgacgtgaccgtgacgacgccgggggagaccgtcaccctccgtgccggg
ttccgcaccgtctcgatcgaggacggggtcttcctcgtcaacggcgcccccgtgaagctg
cgtggggtcaaccgccacgagttcgacccgcttcgtggccgctcggtcaccccggagcgc
atgctcgaggacgtcctcctcatgaagcgtcaccacgtcaacgccgtgcgcaccagccac
tacccgccgcacccgcacttcctcgacctgtgcgacgagcacggcctgtacgtcgtcgac
gagaacgacctcgagacgcacgggttcatcgacgggggatgggtcggcaaccccaccgac
gacccggcgtgggaggacgtcctcgtcgaccgtgtcacccggaccgtccgccgcgacgcc
caccacccgagcatcgtcctgtggtcgctcggcaacgaggccggcagcgggtgcaacgtc
gccgccatgaccgcggccgtccgcgccctcgacccgacccgcccggtgcactacgagggc
gactggtcctccgacgacgtcgacgtgtactcccgcatgtacgcgacgagcgaggagacc
gagctcatcggccagggcgtcgaggcgccgctcgcccgcgccgaggccgacgcccgccgc
cgtcagatgccgttcctgcagtgcgagtacgcgcacgcgatgggcaacggtcccggcggg
ctgagcgactacgacgcgatcttcgaccggtacccgcgactcatgggcgggttcatctgg
gagtggatcgaccacggcctcacgcgccgcaccgacgacgggaccgagttcgcggcctac
ggcggcgacttcggcgaggacttccacgacggcaccttcatcgccgacggcctcgtcctg
cccgaccgcacgccggccccgtcgctcgtcgagatggccgcggtcttcgcacccgtgcgc
ctcgacccgacggccgacgggaccaccctgctggtccgcaaccggtacgccttccgcgac
acctcgcacctgaccttcgagtggaccctccaccacggggacgacgtcctcgccacggac
accctcgacgacctcgtgctcgcacccggtgaggagcggagcgtcgccccgcccgcgggc
ctcgacctgccgtcgcccgaccacaccccgacctggtggacgctgcgtgcggtccagcac
gaggccgaccacctcgacgcaccgtggttcgacgacgcggccgggtcgttcgtcgtgtcc
agcggccagctcgccctgaccccggccgtctccctgccggaggcgaccggccgcgcgcag
cagacctcggacggcttcaccgtcgggcacgcgcgcttcgacgcgcgcggcaccctcctc
gagctgcacgggcgcccggtggccgagctgcgcgtggacgcctggcgcgcaccgaccgac
aacgaccgtcgcgagggcagctgggtcgacctctcggacgagagcgtctggaaggagagc
ggcctgcacctgctcgccgagcgcaaggtctcggccgagatcacggacggcgcgctggtc
gtgaccgcccgcaccgcaggcccacgcacccgcaacgggttccgcaccgtgtacacgtgg
cgccctgtcgccgacggctcagacgacgtcgacctgcacgtcgccatcacccccgagggg
cgctggggccagagcatcgcgcgcctcggtgtgctgctcgtgctcgacgagcccggagcc
gaggacgtcgccgtgcgctggcacgggctcggcccggaggagtcgtactccgactcccgg
aaggctgccgtcggcggtgcgtacgagcacaccgtccgcagcctgcagacgcgctacacg
cacccgcaggagaacggcgcccgacgcggcgtgacccacgcggagctgaccttcgccgac
gggtcggagctcacgctcgacgccggaccgagcagtgtcggcggccgcagcacggcaggc
ctcgagctgtcgctgcgcccgtggtccgacacggcactcgaccaggccgcgcacccgcac
gacctcgtgcccgacgggaagctctggctgcacctcgacgcccgccagcacggcttgggc
agcgcggcgtgcggaccgggcgtgctctccaacgcccgcctcacggcggcgccggccgag
gtgtcggtgcggctcgcgtcgcagccggtgggacgctga

DBGET integrated database retrieval system