KEGG   Sanguibacter keddieii: Sked_14320Help
Entry
Sked_14320        CDS       T01214                                 

Definition
beta-galactosidase/beta-glucuronidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ske  Sanguibacter keddieii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ske00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ske00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ske00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1611715..1614693
Genome map
AA seq 992 aa AA seqDB search
MPRHDTVSLPTGTVPARFRPPTGASDAASVSLDGPWRFRLFPSADTGADPADRGDEWDTI
EVPGHWQLAGAPDTWPYGTPAYSNVLYPFPVEPPFVPDANPTGEYRRTFEVPAGWAADGR
AYLRFEGVDSWFEVSVNGAVVATSHGSRLATEIDVTDVVVPGENLLSVRVTQWSALSYVE
DQDQWWLSGIFRSVTLEHRPEASVAHATVVADYDHTTGTGSLTVEVEGSAEARVTVPELG
IDVAAGETATAQVEPWSAERPRLYDVTVTTPGETVTLRAGFRTVSIEDGVFLVNGAPVKL
RGVNRHEFDPLRGRSVTPERMLEDVLLMKRHHVNAVRTSHYPPHPHFLDLCDEHGLYVVD
ENDLETHGFIDGGWVGNPTDDPAWEDVLVDRVTRTVRRDAHHPSIVLWSLGNEAGSGCNV
AAMTAAVRALDPTRPVHYEGDWSSDDVDVYSRMYATSEETELIGQGVEAPLARAEADARR
RQMPFLQCEYAHAMGNGPGGLSDYDAIFDRYPRLMGGFIWEWIDHGLTRRTDDGTEFAAY
GGDFGEDFHDGTFIADGLVLPDRTPAPSLVEMAAVFAPVRLDPTADGTTLLVRNRYAFRD
TSHLTFEWTLHHGDDVLATDTLDDLVLAPGEERSVAPPAGLDLPSPDHTPTWWTLRAVQH
EADHLDAPWFDDAAGSFVVSSGQLALTPAVSLPEATGRAQQTSDGFTVGHARFDARGTLL
ELHGRPVAELRVDAWRAPTDNDRREGSWVDLSDESVWKESGLHLLAERKVSAEITDGALV
VTARTAGPRTRNGFRTVYTWRPVADGSDDVDLHVAITPEGRWGQSIARLGVLLVLDEPGA
EDVAVRWHGLGPEESYSDSRKAAVGGAYEHTVRSLQTRYTHPQENGARRGVTHAELTFAD
GSELTLDAGPSSVGGRSTAGLELSLRPWSDTALDQAAHPHDLVPDGKLWLHLDARQHGLG
SAACGPGVLSNARLTAAPAEVSVRLASQPVGR
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgtcacgacaccgtcagcctgccgaccgggaccgttcccgcgcggttccgcccg
ccgacaggcgcctccgacgccgcgtcggtgagcctcgacggcccgtggcgcttccggctg
ttcccgtcggccgacaccggtgccgaccctgcagaccgcggcgacgagtgggacaccatc
gaggtccccgggcactggcagctcgccggtgcacccgacacctggccctacggcaccccg
gcctacagcaacgtgctctaccccttcccggtcgagccgcccttcgtgcccgacgcgaac
ccgacgggggagtaccgccggaccttcgaggtcccggccgggtgggccgctgacggtcgc
gcctacctgcgcttcgagggcgtggactcgtggttcgaggtgtcggtcaacggcgccgtc
gtcgccacctcgcacggctcccgcctggcgacagagatcgacgtcaccgacgtcgtcgtc
ccgggcgagaacctgctctcggtccgcgtgacccagtggtcggcgctcagctacgtcgag
gaccaggaccagtggtggctgtcgggcatcttccgcagcgtgaccctcgagcaccggccg
gaggcgagcgtcgcgcacgcgaccgtcgtcgcggactacgaccacaccacggggaccggc
tcgctcaccgtcgaggtcgagggatctgccgaggctcgcgtcaccgtccccgagctcggc
atcgacgtcgcggccggcgagaccgcgactgcgcaggtcgagccgtggagcgccgagcgg
ccgcgtctctacgacgtgaccgtgacgacgccgggggagaccgtcaccctccgtgccggg
ttccgcaccgtctcgatcgaggacggggtcttcctcgtcaacggcgcccccgtgaagctg
cgtggggtcaaccgccacgagttcgacccgcttcgtggccgctcggtcaccccggagcgc
atgctcgaggacgtcctcctcatgaagcgtcaccacgtcaacgccgtgcgcaccagccac
tacccgccgcacccgcacttcctcgacctgtgcgacgagcacggcctgtacgtcgtcgac
gagaacgacctcgagacgcacgggttcatcgacgggggatgggtcggcaaccccaccgac
gacccggcgtgggaggacgtcctcgtcgaccgtgtcacccggaccgtccgccgcgacgcc
caccacccgagcatcgtcctgtggtcgctcggcaacgaggccggcagcgggtgcaacgtc
gccgccatgaccgcggccgtccgcgccctcgacccgacccgcccggtgcactacgagggc
gactggtcctccgacgacgtcgacgtgtactcccgcatgtacgcgacgagcgaggagacc
gagctcatcggccagggcgtcgaggcgccgctcgcccgcgccgaggccgacgcccgccgc
cgtcagatgccgttcctgcagtgcgagtacgcgcacgcgatgggcaacggtcccggcggg
ctgagcgactacgacgcgatcttcgaccggtacccgcgactcatgggcgggttcatctgg
gagtggatcgaccacggcctcacgcgccgcaccgacgacgggaccgagttcgcggcctac
ggcggcgacttcggcgaggacttccacgacggcaccttcatcgccgacggcctcgtcctg
cccgaccgcacgccggccccgtcgctcgtcgagatggccgcggtcttcgcacccgtgcgc
ctcgacccgacggccgacgggaccaccctgctggtccgcaaccggtacgccttccgcgac
acctcgcacctgaccttcgagtggaccctccaccacggggacgacgtcctcgccacggac
accctcgacgacctcgtgctcgcacccggtgaggagcggagcgtcgccccgcccgcgggc
ctcgacctgccgtcgcccgaccacaccccgacctggtggacgctgcgtgcggtccagcac
gaggccgaccacctcgacgcaccgtggttcgacgacgcggccgggtcgttcgtcgtgtcc
agcggccagctcgccctgaccccggccgtctccctgccggaggcgaccggccgcgcgcag
cagacctcggacggcttcaccgtcgggcacgcgcgcttcgacgcgcgcggcaccctcctc
gagctgcacgggcgcccggtggccgagctgcgcgtggacgcctggcgcgcaccgaccgac
aacgaccgtcgcgagggcagctgggtcgacctctcggacgagagcgtctggaaggagagc
ggcctgcacctgctcgccgagcgcaaggtctcggccgagatcacggacggcgcgctggtc
gtgaccgcccgcaccgcaggcccacgcacccgcaacgggttccgcaccgtgtacacgtgg
cgccctgtcgccgacggctcagacgacgtcgacctgcacgtcgccatcacccccgagggg
cgctggggccagagcatcgcgcgcctcggtgtgctgctcgtgctcgacgagcccggagcc
gaggacgtcgccgtgcgctggcacgggctcggcccggaggagtcgtactccgactcccgg
aaggctgccgtcggcggtgcgtacgagcacaccgtccgcagcctgcagacgcgctacacg
cacccgcaggagaacggcgcccgacgcggcgtgacccacgcggagctgaccttcgccgac
gggtcggagctcacgctcgacgccggaccgagcagtgtcggcggccgcagcacggcaggc
ctcgagctgtcgctgcgcccgtggtccgacacggcactcgaccaggccgcgcacccgcac
gacctcgtgcccgacgggaagctctggctgcacctcgacgcccgccagcacggcttgggc
agcgcggcgtgcggaccgggcgtgctctccaacgcccgcctcacggcggcgccggccgag
gtgtcggtgcggctcgcgtcgcagccggtgggacgctga

DBGET integrated database retrieval system