KEGG   Sanguibacter keddieii: Sked_15460Help
Entry
Sked_15460        CDS       T01214                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ske  Sanguibacter keddieii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sked_15460
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sked_15460
  Amino acid metabolism
   00310 Lysine degradation
    Sked_15460
Enzymes [BR:ske01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sked_15460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1730411..1732156)
Genome map
AA seq 581 aa AA seqDB search
MSDTVQMPALGESVTEGTVTRWLKAVGETVELDEPLLEVSTDKVDTEIPSPFAGVLEKIL
VEEDETVEVGAALAEIGSGEGSSDSAPAEEPAAEAPAEEEAPAAPAAQDESPSPATPEAK
ADSAPAEGGDGEEIKLPALGESVTEGTVTRWLKAVGDTVDVDEPLLEVSTDKVDTEVPSP
IAGTLQKILVEEDETVEVGTVLAIIGSGAAAESAPAEKAPEPKAEEKVEAPKAEAPKAEA
KTEAPKAEAPKADAPKAEASAPSTSGGSYLTPLVRKLASEKGVDISTVTGTGVGGRIRKE
DVLEAAAKAEEAAKAAAAPKESAPAETAPSAKPSKASVPEVSPLRGTTEKASRLRKIIAE
RMVEALHSQAQLTTVVEVDVTRVARLRAKAKDGFKAREGANLTFLPFFALAAVEALKAYP
KINGVLEGDQITYHAQENVGIAVDTPRGLLVPVIRDAGDLNLGGIARKIVDLATRTRDNK
VGPDELSGATFTITNTGSGGALIDTPIVPGGTSAILGTGTIVKRPAVITDADGAEVIAIR
SICYLSLSYDHRLVDGADASRYLTAIKKRIEEGAFESEVGL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaccgtgcagatgcccgcactgggcgaatcagtcaccgaaggcaccgtcacc
cgttggctcaaggccgtcggcgagaccgtggagctggacgagcccttgctcgaggtctcg
accgacaaggtcgacaccgagatcccgtcgccgttcgccggcgtgctcgagaagatcctg
gtcgaggaggacgagaccgtcgaggtcggcgccgctctcgccgagatcggctcgggcgag
ggctcgagcgactcggcacccgccgaggagcccgcagccgaggctcctgccgaggaggag
gcacctgctgcccccgccgcgcaggacgagtctccctcccccgccacccctgaggcgaag
gccgactcggcccccgccgagggcggcgacggcgaggagatcaagctccccgcgctcgga
gagtccgtcaccgagggcaccgtgacccgctggctcaaggctgtcggcgacaccgtcgac
gtcgacgagccgctgctcgaggtctcgaccgacaaggtcgacaccgaggtcccgtcgccc
atcgccggcacgctccagaagatcctggtcgaggaggacgagaccgtcgaggtcggcacc
gtcctcgcgatcatcggctccggcgctgctgctgagtcggccccggccgagaaggctccc
gagccgaaggccgaggagaaggtcgaggctccgaaggctgaggcccccaaggccgaggcg
aagaccgaggcgccgaaggccgaggcccccaaggccgacgcaccgaaggccgaggcctcc
gcgccgtcgacctccggcggctcctacctcaccccgctcgtgcgcaagctcgcgtctgag
aagggtgtcgacatctcgaccgtcaccggcaccggtgtgggaggacgcatccgcaaggag
gacgtcctcgaggctgctgccaaggccgaggaggccgccaaggctgctgccgccccgaag
gaatcggctccggccgagaccgcaccgtcggccaagccctcgaaggcgtcggtccccgag
gtctcgccgctgcgcggcacgaccgagaaggccagccgcctgcgcaagatcatcgccgag
cgcatggtcgaggccctgcactcgcaggcgcagctcaccacggtcgtcgaggtcgacgtg
acccgcgtcgcgcgcctgcgcgccaaggcgaaggacggcttcaaggcacgcgagggcgcc
aacctcacgttcctgcccttcttcgccctcgcggcggtcgaggccctcaaggcctacccg
aagatcaacggtgtgctcgagggcgaccagatcacctaccacgcacaggagaacgtcggc
atcgccgtcgacaccccgcgcggtctgctggtcccggtcatccgcgacgccggtgacctc
aacctcggtggcatcgcccgcaagatcgtggacctcgcgacgcgtacgcgcgacaacaag
gtcggtccggacgagctcagcggcgccaccttcacgatcaccaacaccggctcgggcggg
gcgctcatcgacaccccgatcgtccccggcggcacgtcggcgatcctcggcaccggcacg
atcgtcaagcgtcccgcagtgatcaccgacgccgacggcgccgaggtcatcgcgatccgc
tcgatctgctacctctcgctctcctacgaccaccgtctggtcgacggcgccgacgcgtcg
cgctacctcacggcgatcaagaagcgcatcgaagagggtgccttcgagtccgaggtcggt
ctctga

DBGET integrated database retrieval system