KEGG   Sanguibacter keddieii: Sked_15460Help
Entry
Sked_15460        CDS       T01214                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ske  Sanguibacter keddieii
Pathway
ske00020  Citrate cycle (TCA cycle)
ske00310  Lysine degradation
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01120  Microbial metabolism in diverse environments
ske01130  Biosynthesis of antibiotics
ske01200  Carbon metabolism
Module
ske_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ske_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sked_15460
  Amino acid metabolism
   00310 Lysine degradation
    Sked_15460
Enzymes [BR:ske01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sked_15460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACZ21481
UniProt: D1BFX0
Position
complement(1730411..1732156)
Genome map
AA seq 581 aa AA seqDB search
MSDTVQMPALGESVTEGTVTRWLKAVGETVELDEPLLEVSTDKVDTEIPSPFAGVLEKIL
VEEDETVEVGAALAEIGSGEGSSDSAPAEEPAAEAPAEEEAPAAPAAQDESPSPATPEAK
ADSAPAEGGDGEEIKLPALGESVTEGTVTRWLKAVGDTVDVDEPLLEVSTDKVDTEVPSP
IAGTLQKILVEEDETVEVGTVLAIIGSGAAAESAPAEKAPEPKAEEKVEAPKAEAPKAEA
KTEAPKAEAPKADAPKAEASAPSTSGGSYLTPLVRKLASEKGVDISTVTGTGVGGRIRKE
DVLEAAAKAEEAAKAAAAPKESAPAETAPSAKPSKASVPEVSPLRGTTEKASRLRKIIAE
RMVEALHSQAQLTTVVEVDVTRVARLRAKAKDGFKAREGANLTFLPFFALAAVEALKAYP
KINGVLEGDQITYHAQENVGIAVDTPRGLLVPVIRDAGDLNLGGIARKIVDLATRTRDNK
VGPDELSGATFTITNTGSGGALIDTPIVPGGTSAILGTGTIVKRPAVITDADGAEVIAIR
SICYLSLSYDHRLVDGADASRYLTAIKKRIEEGAFESEVGL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaccgtgcagatgcccgcactgggcgaatcagtcaccgaaggcaccgtcacc
cgttggctcaaggccgtcggcgagaccgtggagctggacgagcccttgctcgaggtctcg
accgacaaggtcgacaccgagatcccgtcgccgttcgccggcgtgctcgagaagatcctg
gtcgaggaggacgagaccgtcgaggtcggcgccgctctcgccgagatcggctcgggcgag
ggctcgagcgactcggcacccgccgaggagcccgcagccgaggctcctgccgaggaggag
gcacctgctgcccccgccgcgcaggacgagtctccctcccccgccacccctgaggcgaag
gccgactcggcccccgccgagggcggcgacggcgaggagatcaagctccccgcgctcgga
gagtccgtcaccgagggcaccgtgacccgctggctcaaggctgtcggcgacaccgtcgac
gtcgacgagccgctgctcgaggtctcgaccgacaaggtcgacaccgaggtcccgtcgccc
atcgccggcacgctccagaagatcctggtcgaggaggacgagaccgtcgaggtcggcacc
gtcctcgcgatcatcggctccggcgctgctgctgagtcggccccggccgagaaggctccc
gagccgaaggccgaggagaaggtcgaggctccgaaggctgaggcccccaaggccgaggcg
aagaccgaggcgccgaaggccgaggcccccaaggccgacgcaccgaaggccgaggcctcc
gcgccgtcgacctccggcggctcctacctcaccccgctcgtgcgcaagctcgcgtctgag
aagggtgtcgacatctcgaccgtcaccggcaccggtgtgggaggacgcatccgcaaggag
gacgtcctcgaggctgctgccaaggccgaggaggccgccaaggctgctgccgccccgaag
gaatcggctccggccgagaccgcaccgtcggccaagccctcgaaggcgtcggtccccgag
gtctcgccgctgcgcggcacgaccgagaaggccagccgcctgcgcaagatcatcgccgag
cgcatggtcgaggccctgcactcgcaggcgcagctcaccacggtcgtcgaggtcgacgtg
acccgcgtcgcgcgcctgcgcgccaaggcgaaggacggcttcaaggcacgcgagggcgcc
aacctcacgttcctgcccttcttcgccctcgcggcggtcgaggccctcaaggcctacccg
aagatcaacggtgtgctcgagggcgaccagatcacctaccacgcacaggagaacgtcggc
atcgccgtcgacaccccgcgcggtctgctggtcccggtcatccgcgacgccggtgacctc
aacctcggtggcatcgcccgcaagatcgtggacctcgcgacgcgtacgcgcgacaacaag
gtcggtccggacgagctcagcggcgccaccttcacgatcaccaacaccggctcgggcggg
gcgctcatcgacaccccgatcgtccccggcggcacgtcggcgatcctcggcaccggcacg
atcgtcaagcgtcccgcagtgatcaccgacgccgacggcgccgaggtcatcgcgatccgc
tcgatctgctacctctcgctctcctacgaccaccgtctggtcgacggcgccgacgcgtcg
cgctacctcacggcgatcaagaagcgcatcgaagagggtgccttcgagtccgaggtcggt
ctctga

DBGET integrated database retrieval system