KEGG   Sanguibacter keddieii: Sked_18030Help
Entry
Sked_18030        CDS       T01214                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ske  Sanguibacter keddieii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sked_18030
Enzymes [BR:ske01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sked_18030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2011183..2011782
Genome map
AA seq 199 aa AA seqDB search
MPATPPAPESSRLTVLAGPTAVGKGTVSADIRARYPDIWLSVSATTRQPRPGEVDGVHYL
FVGPDRFADMVANSELLEWAVVHGRNSYGTPRGPVQEKLDAGVATLLEIDLQGARQVRAT
MPEARFVFLAPPSWEELERRLVGRGTEGPEERERRLATAKVEMAAASEFDHVIVNDDVQR
AADELVSVMGLAPHPVAGR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
attcctgcaacgccccccgcacccgagtcctcgcgcctgacggtcctcgccggacccacg
gccgtcggcaagggcacggtctccgctgacatccgtgcgcgctaccccgacatctggctg
tccgtctccgcgacgacacgccagcctcgccccggcgaggtcgacggggtccactacctg
ttcgtcgggcccgaccggttcgccgacatggtggcgaacagcgagctcctcgagtgggcc
gtggtgcacgggcgcaacagttacgggaccccgcggggtcccgtgcaggagaagctcgac
gccggcgtggcgaccctcctggagatcgacctccagggggctcgtcaggtccgcgcgacc
atgcccgaggcccgcttcgtgttcctcgccccgcccagctgggaagagctcgagcgccgc
ctcgtcgggcgtggcacagagggtcccgaggagcgcgagcgtcgtctcgcgaccgcgaag
gtcgagatggccgccgcctcggagttcgaccacgtcatcgtcaacgacgacgtgcagcgc
gccgccgacgagctcgtctcggtcatggggctcgcgccgcaccccgtcgccggtcgctga

DBGET integrated database retrieval system