KEGG   Sanguibacter keddieii: Sked_19370Help
Entry
Sked_19370        CDS       T01214                                 

Definition
(GenBank) ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component
  KO
K15555  sulfonate transport system ATP-binding protein [EC:3.6.3.-]
Organism
ske  Sanguibacter keddieii
Pathway
ske00920  Sulfur metabolism
ske02010  ABC transporters
Module
ske_M00436  Sulfonate transport system
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Sked_19370
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Sked_19370
Enzymes [BR:ske01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Sked_19370
Transporters [BR:ske02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfonate transporter [MD:M00436]
    Sked_19370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_22 AAA_16 RsgA_GTPase AAA_21 AAA_28 AAA_29 NACHT NB-ARC MMR_HSR1 Viral_helicase1 G-alpha AAA_18 AAA_30 ATPase_2
Motif
Other DBs
NCBI-ProteinID: ACZ21862
UniProt: D1BHE2
Position
complement(2157535..2158515)
Genome map
AA seq 326 aa AA seqDB search
MSLAERPSRPASPATPAQAPAVHAQAAQTVTLRHVHRTFATPAGPRAVLADVDLTITAGE
IVAVLGTSGCGKSTLLRQVSGLDTPSTGEILIGETAVHGVDDRTAVAFQEPRLLPWRTIA
QNVRLGLPRGTSKSAGAARVAELLELVGLTASADLRPRQVSGGMAQRASLARALARNPAV
LLLDEPFGALDALTRLKMQDLLLTVHAAEPTTVVLVTHDVDEALVLADRIVLLRTVDPAA
DSAPDGARSVRAVIDVPGARPRDHADAELAALRTELLSGLGVPARVAGPSHTQAPHTPAP
HVAAPAASDTASAAPTTSHVPTEESA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgccgaacgcccctcgcgccccgcctcgccggcgacgcccgcgcaggctccc
gctgtccacgcgcaggccgcccagacggtgaccctgcgccacgtgcaccgcaccttcgcc
acccccgccggtccgcgagcggtcctcgccgacgtcgacctcacgatcaccgccggtgag
atcgtcgccgtcctcggcacctcgggctgcggcaagtcgaccctgctgcgccaggtgagc
ggcctcgacaccccgagcacgggggagatcctcatcggggagaccgcggtccacggcgtc
gacgaccgcacggccgtcgccttccaggagccgcggctgctgccctggcgcacgatcgct
cagaacgtgcggctcggtctgccgcgcggcacatccaagtccgccggggctgcgcgcgtc
gccgagctgctcgagctggtcggtctcaccgcctccgcggacctgcgtccccggcaggtc
tcgggcgggatggcccagcgcgcctcgctcgcgagggccctcgcccgcaacccggcggtc
ctgctcctcgacgagcccttcggtgcgctcgacgcgctgacccgcctcaagatgcaggac
ctcctgctcaccgtgcacgccgccgagcccaccacggtcgtgctcgtcacccacgacgtc
gacgaggccctcgtcctcgccgaccggatcgtgctgctccgcaccgtcgacccggcagcc
gactcagccccggacggcgctcgctccgtccgggccgtgatcgacgtccccggcgctcgt
ccccgcgaccacgccgacgccgagctcgccgccctgcgcaccgagctcctcagcggcctc
ggcgtcccggcccgggtcgccggtccctcgcacacccaggcaccgcacaccccagcacct
cacgtcgcggctcccgcggcgtcagacacagcatcagcagcacccacgacatcacacgtc
cccaccgaggagtccgcatga

DBGET integrated database retrieval system