KEGG   Sanguibacter keddieii: Sked_19370Help
Entry
Sked_19370        CDS       T01214                                 

Definition
nitrate/sulfonate/bicarbonate ABC transporter ATPase
Orthology
K15555  
sulfonate transport system ATP-binding protein [EC:3.6.3.-]
Organism
ske  Sanguibacter keddieii
Pathway
Sulfur metabolism
ABC transporters
Module
Sulfonate transport system
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Sked_19370
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Sked_19370
Enzymes [BR:ske01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Sked_19370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2157535..2158515)
Genome map
AA seq 326 aa AA seqDB search
MSLAERPSRPASPATPAQAPAVHAQAAQTVTLRHVHRTFATPAGPRAVLADVDLTITAGE
IVAVLGTSGCGKSTLLRQVSGLDTPSTGEILIGETAVHGVDDRTAVAFQEPRLLPWRTIA
QNVRLGLPRGTSKSAGAARVAELLELVGLTASADLRPRQVSGGMAQRASLARALARNPAV
LLLDEPFGALDALTRLKMQDLLLTVHAAEPTTVVLVTHDVDEALVLADRIVLLRTVDPAA
DSAPDGARSVRAVIDVPGARPRDHADAELAALRTELLSGLGVPARVAGPSHTQAPHTPAP
HVAAPAASDTASAAPTTSHVPTEESA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgccgaacgcccctcgcgccccgcctcgccggcgacgcccgcgcaggctccc
gctgtccacgcgcaggccgcccagacggtgaccctgcgccacgtgcaccgcaccttcgcc
acccccgccggtccgcgagcggtcctcgccgacgtcgacctcacgatcaccgccggtgag
atcgtcgccgtcctcggcacctcgggctgcggcaagtcgaccctgctgcgccaggtgagc
ggcctcgacaccccgagcacgggggagatcctcatcggggagaccgcggtccacggcgtc
gacgaccgcacggccgtcgccttccaggagccgcggctgctgccctggcgcacgatcgct
cagaacgtgcggctcggtctgccgcgcggcacatccaagtccgccggggctgcgcgcgtc
gccgagctgctcgagctggtcggtctcaccgcctccgcggacctgcgtccccggcaggtc
tcgggcgggatggcccagcgcgcctcgctcgcgagggccctcgcccgcaacccggcggtc
ctgctcctcgacgagcccttcggtgcgctcgacgcgctgacccgcctcaagatgcaggac
ctcctgctcaccgtgcacgccgccgagcccaccacggtcgtgctcgtcacccacgacgtc
gacgaggccctcgtcctcgccgaccggatcgtgctgctccgcaccgtcgacccggcagcc
gactcagccccggacggcgctcgctccgtccgggccgtgatcgacgtccccggcgctcgt
ccccgcgaccacgccgacgccgagctcgccgccctgcgcaccgagctcctcagcggcctc
ggcgtcccggcccgggtcgccggtccctcgcacacccaggcaccgcacaccccagcacct
cacgtcgcggctcccgcggcgtcagacacagcatcagcagcacccacgacatcacacgtc
cccaccgaggagtccgcatga

DBGET integrated database retrieval system