KEGG   Sanguibacter keddieii: Sked_19820Help
Entry
Sked_19820        CDS       T01214                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ske  Sanguibacter keddieii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sked_19820
   00052 Galactose metabolism
    Sked_19820
   00500 Starch and sucrose metabolism
    Sked_19820
   00520 Amino sugar and nucleotide sugar metabolism
    Sked_19820
Enzymes [BR:ske01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sked_19820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2205669..2207066)
Genome map
AA seq 465 aa AA seqDB search
MSDSGLLQAQQKMRDGGVAGTAIDVFSHFYRLLESGETGVIPESDVDPLVDVDKQSELDV
PEQVGKDALAKTAIIKLNGGLGTSMGMDKAKSLLTVRGDETFLDIIVGQVRHARATSGAR
LPLIFMNSFRTRDDTLAALDKHADVAVDGVPLDFIQNREPKLRADDLTPVTWEADPSLEW
CPPGHGDLYTALQTSGVLTALLEAGFEYAHVSNSDNLGASPDAAVAGWFAQSGAPFGAEV
AVRTPADRKGGHQVVRKSDGRIVLRETAQTLDEDAAAAADISKHKYFNTNNLWFDLKALA
AELERTGGVLQLPLIKNSKTVDPSDASSTPVIQIESAMGAAIEVFEGARVLEVDRSRFLP
VKTTNDLLVLRSDVYELGEDYRLTAAVEAPYVDLDPDHYKTIGKFDARFAQGAPSLVRAT
ALRVEGDWTFEAGVTAVGEARLTDPGQPGTVPSGTTISADGLDVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactcaggacttctccaggcccagcagaagatgcgcgacggtggggtggccggg
acggcgatcgacgtcttctcccacttctaccggctgctcgagtcgggggagacgggggtc
atccccgagtccgacgtggaccctctggtcgacgtcgacaagcagtcggagctggacgtc
ccggagcaggtgggcaaggacgccctggcgaagacggcgatcatcaagctcaacggcggc
ctcggcacgtcgatgggcatggacaaggccaagtcgctgctgaccgtccgcggcgacgag
acgttcctcgacatcatcgtcggccaggtacgccacgcacgggcgacgtcgggcgcgcgg
ctgcccctgatcttcatgaacagcttccggacgcgtgacgacaccctcgcggccctcgac
aagcacgccgacgtggctgtcgacggagtcccgctggacttcatccagaaccgcgagccc
aagctgcgcgccgacgacctcaccccggtgacgtgggaggccgacccgagcctcgagtgg
tgccctccgggccacggggacctgtacacggccctgcagacgtcaggggtgctcacagcg
ctcctggaggccggcttcgagtacgcgcacgtgtcgaactccgacaacctcggtgcgtca
cccgacgcggccgtcgccggctggttcgcgcagtccggtgcgcccttcggcgcggaggtc
gccgtgcggacgccagcagaccgcaagggaggccaccaggtggtccgcaagagcgacggg
aggatcgtcctgcgggagacggcccagaccctcgacgaggacgctgcagcggctgctgac
atctccaagcacaagtacttcaacaccaacaacctctggttcgacctcaaggccctcgcc
gccgagctcgagcgcaccggtggtgtgctgcagctgccgctgatcaagaactccaagacc
gtggacccctccgacgcgtcgtccactcccgtgatccagatcgagtccgccatgggcgcc
gccatcgaagtcttcgagggcgccagggtgctggaggtcgaccggtccaggttcctgccc
gtgaagaccaccaacgacctcctggtgctccgcagcgacgtctacgagctgggggaggac
tacaggctcacagcggccgtcgaggccccgtacgtggacctggatcccgaccactacaag
accatcgggaagttcgacgctcgcttcgcccagggggctccgtcgctggtcagggctacg
gcgctgagggtcgagggggactggaccttcgaggccggcgtgacggctgtgggggaggcg
cggctgaccgacccgggccagcccggaaccgtcccgtccgggaccacgatcagcgccgac
ggcctcgacgtgtcgtga

DBGET integrated database retrieval system