KEGG   Sanguibacter keddieii: Sked_20010Help
Entry
Sked_20010        CDS       T01214                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ske  Sanguibacter keddieii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sked_20010
   01230 Biosynthesis of amino acids
    Sked_20010
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_20010
   00051 Fructose and mannose metabolism
    Sked_20010
   00562 Inositol phosphate metabolism
    Sked_20010
Enzymes [BR:ske01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sked_20010
Exosome [BR:ske04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sked_20010
  Exosomal proteins of bladder cancer cells
   Sked_20010
  Exosomal proteins of melanoma cells
   Sked_20010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2225900..2226694)
Genome map
AA seq 264 aa AA seqDB search
MANARTPLIAGNWKMNQDHQEAIHLVQKLAWALKDAKHDFSQVEVTVLAPFTDLRSVQTL
VDADKLELTYGAQDVSQHVSGAYTGEISPVFLSKLGVTYVAVGHSERRQYHNEDDALVNA
KSKAALAHGIIPIICVGEPLEVRKAGDQVSHTLAQVDGALEGFSAEDAAKVVIAYEPVWA
IGTGEVATPQDAQEVAGAIRVRLAELYSADVADAVRVLYGGSVKSSSIAELMKETDVDGA
LVGGASLDAEEFAKIAQFKAAAAS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgcccgtacgcccctcatcgccggcaactggaagatgaaccaggaccaccag
gaggccatccacctggtgcagaagctcgcctgggccctcaaggacgccaagcacgacttc
tcgcaggtcgaggtgaccgtcctcgcgccgttcaccgacctccgcagcgtccagacgctc
gtcgacgccgacaagctcgagctcacctacggtgcgcaggacgtctcgcagcacgtctcg
ggcgcctacaccggtgagatctcgccggtgttcctcagcaagctcggcgtcacctacgtg
gccgtgggccactcggagcgccgccagtaccacaacgaggacgacgccctcgtcaacgcg
aagtcgaaggccgccctggcccacggcatcatcccgatcatctgcgtcggcgagcccctc
gaggtccgcaaggccggagaccaggtctcgcacacgctcgcccaggtcgacggtgcgctc
gagggcttctcggccgaagacgccgccaaggtcgtcatcgcctacgagcccgtctgggcc
atcggcaccggtgaggtcgccaccccgcaggacgctcaggaggtcgccggcgcgatccgc
gtccgcctcgccgagctctactcggccgacgtcgccgacgccgtccgcgtgctctacggc
ggttcggtcaagtcctcgtcgatcgccgagctcatgaaggagacggacgtcgacggcgcc
ctcgtcggaggcgccagcctcgacgccgaggagttcgccaagatcgcccagttcaaggct
gccgccgcgagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system