KEGG   Sanguibacter keddieii: Sked_20010Help
Entry
Sked_20010        CDS       T01214                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ske  Sanguibacter keddieii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sked_20010
   01230 Biosynthesis of amino acids
    Sked_20010
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_20010
   00051 Fructose and mannose metabolism
    Sked_20010
   00562 Inositol phosphate metabolism
    Sked_20010
Enzymes [BR:ske01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sked_20010
Exosome [BR:ske04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sked_20010
  Exosomal proteins of bladder cancer cells
   Sked_20010
  Exosomal proteins of melanoma cells
   Sked_20010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2225900..2226694)
Genome map
AA seq 264 aa AA seqDB search
MANARTPLIAGNWKMNQDHQEAIHLVQKLAWALKDAKHDFSQVEVTVLAPFTDLRSVQTL
VDADKLELTYGAQDVSQHVSGAYTGEISPVFLSKLGVTYVAVGHSERRQYHNEDDALVNA
KSKAALAHGIIPIICVGEPLEVRKAGDQVSHTLAQVDGALEGFSAEDAAKVVIAYEPVWA
IGTGEVATPQDAQEVAGAIRVRLAELYSADVADAVRVLYGGSVKSSSIAELMKETDVDGA
LVGGASLDAEEFAKIAQFKAAAAS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgcccgtacgcccctcatcgccggcaactggaagatgaaccaggaccaccag
gaggccatccacctggtgcagaagctcgcctgggccctcaaggacgccaagcacgacttc
tcgcaggtcgaggtgaccgtcctcgcgccgttcaccgacctccgcagcgtccagacgctc
gtcgacgccgacaagctcgagctcacctacggtgcgcaggacgtctcgcagcacgtctcg
ggcgcctacaccggtgagatctcgccggtgttcctcagcaagctcggcgtcacctacgtg
gccgtgggccactcggagcgccgccagtaccacaacgaggacgacgccctcgtcaacgcg
aagtcgaaggccgccctggcccacggcatcatcccgatcatctgcgtcggcgagcccctc
gaggtccgcaaggccggagaccaggtctcgcacacgctcgcccaggtcgacggtgcgctc
gagggcttctcggccgaagacgccgccaaggtcgtcatcgcctacgagcccgtctgggcc
atcggcaccggtgaggtcgccaccccgcaggacgctcaggaggtcgccggcgcgatccgc
gtccgcctcgccgagctctactcggccgacgtcgccgacgccgtccgcgtgctctacggc
ggttcggtcaagtcctcgtcgatcgccgagctcatgaaggagacggacgtcgacggcgcc
ctcgtcggaggcgccagcctcgacgccgaggagttcgccaagatcgcccagttcaaggct
gccgccgcgagctga

DBGET integrated database retrieval system