KEGG   Sanguibacter keddieii: Sked_20200Help
Entry
Sked_20200        CDS       T01214                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ske  Sanguibacter keddieii
Pathway
ske00010  Glycolysis / Gluconeogenesis
ske00030  Pentose phosphate pathway
ske00051  Fructose and mannose metabolism
ske00052  Galactose metabolism
ske00680  Methane metabolism
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01120  Microbial metabolism in diverse environments
ske01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_20200
   00030 Pentose phosphate pathway
    Sked_20200
   00051 Fructose and mannose metabolism
    Sked_20200
   00052 Galactose metabolism
    Sked_20200
  Energy metabolism
   00680 Methane metabolism
    Sked_20200
Enzymes [BR:ske01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sked_20200
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Sked_20200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACZ21944
UniProt: D1BHM4
Position
complement(2252375..2253400)
Genome map
AA seq 341 aa AA seqDB search
MRIGLLTGGGDCPGLNAAIRAVVKQGLGEYGHTIIGFRNGWKGVVDGDVRTMSREDIRNV
LPQGGTLLGTARFHPHSADGGLDGVMATLEAERIEALICIGGDGTLHAANKVAEQGIKIV
AIPKTIDNDVYGTDLSIGFHTAVNIATEAIDRIHTTAESHNRVMVVEVMGRHAGWIAVNA
GIAGGAELVLAPEEPFDMDRIVKFLKHRHRSHANFSIVVVAEGALPKEGSSMQYEAQLGK
FGEIIAGAIGERVANEIATRTGFDTRLTILGHVQRGGTPTPTDRILGSRFGVAAVDAISR
GETNVMTALRNEEVVLVPLEEIAGKVKHVPDDLLRVARVLA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcggtctgctcaccggcggtggcgactgcccagggctgaacgctgcgatccgt
gcggtcgtcaagcaaggtctgggggagtacgggcacaccatcatcggcttccgcaacggc
tggaagggcgtggtcgacggtgacgtccggaccatgtcgcgagaggacatccgcaacgtc
ctcccgcagggcggcacgctcctcggcaccgcacggttccacccgcactccgccgacggc
gggctcgacggcgtcatggccacgctcgaggccgagcgcatcgaggcgctcatctgcatc
ggcggcgacggcaccctccacgccgccaacaaggtcgccgagcagggcatcaagatcgtc
gcgatccccaagacgatcgacaacgacgtctacggcacggacctgtcgatcggcttccac
accgcggtgaacatcgcgaccgaggcgatcgaccgcatccacacgaccgcggagagccac
aaccgcgtcatggtcgtcgaggtcatgggccggcacgccggctggatcgccgtgaacgcc
ggcatcgcgggcggggccgagctcgtgctcgcccccgaggagcccttcgacatggaccgc
atcgtcaagttcctcaagcaccgtcaccgctcgcacgcgaacttctcgatcgtcgtggtc
gccgagggtgcgctgcccaaggagggcagctcgatgcagtacgaggcccagctcggcaag
ttcggcgagatcattgccggtgccatcggcgagcgggtcgccaacgagatcgcgacccgg
accggcttcgacacgcgcctgacgatcctcggtcacgtccagcgcggcggcacgcccacg
ccgaccgaccgcatcctcggcagccgcttcggcgtcgcggccgtcgacgcgatcagccgc
ggcgagaccaacgtcatgacggccctgcgcaacgaagaggtcgtcctcgtcccgctcgag
gagatcgccgggaaggtcaagcacgtccccgacgacctcctcagggtcgcgcgcgtcctc
gcctga

DBGET integrated database retrieval system