KEGG   Sanguibacter keddieii: Sked_20200Help
Entry
Sked_20200        CDS       T01214                                 

Definition
pyrophosphate-dependent phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ske  Sanguibacter keddieii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sked_20200
   01230 Biosynthesis of amino acids
    Sked_20200
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_20200
   00030 Pentose phosphate pathway
    Sked_20200
   00051 Fructose and mannose metabolism
    Sked_20200
   00052 Galactose metabolism
    Sked_20200
  Energy metabolism
   00680 Methane metabolism
    Sked_20200
Enzymes [BR:ske01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sked_20200
Protein phosphatases and associated proteins [BR:ske01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sked_20200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2252375..2253400)
Genome map
AA seq 341 aa AA seqDB search
MRIGLLTGGGDCPGLNAAIRAVVKQGLGEYGHTIIGFRNGWKGVVDGDVRTMSREDIRNV
LPQGGTLLGTARFHPHSADGGLDGVMATLEAERIEALICIGGDGTLHAANKVAEQGIKIV
AIPKTIDNDVYGTDLSIGFHTAVNIATEAIDRIHTTAESHNRVMVVEVMGRHAGWIAVNA
GIAGGAELVLAPEEPFDMDRIVKFLKHRHRSHANFSIVVVAEGALPKEGSSMQYEAQLGK
FGEIIAGAIGERVANEIATRTGFDTRLTILGHVQRGGTPTPTDRILGSRFGVAAVDAISR
GETNVMTALRNEEVVLVPLEEIAGKVKHVPDDLLRVARVLA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcggtctgctcaccggcggtggcgactgcccagggctgaacgctgcgatccgt
gcggtcgtcaagcaaggtctgggggagtacgggcacaccatcatcggcttccgcaacggc
tggaagggcgtggtcgacggtgacgtccggaccatgtcgcgagaggacatccgcaacgtc
ctcccgcagggcggcacgctcctcggcaccgcacggttccacccgcactccgccgacggc
gggctcgacggcgtcatggccacgctcgaggccgagcgcatcgaggcgctcatctgcatc
ggcggcgacggcaccctccacgccgccaacaaggtcgccgagcagggcatcaagatcgtc
gcgatccccaagacgatcgacaacgacgtctacggcacggacctgtcgatcggcttccac
accgcggtgaacatcgcgaccgaggcgatcgaccgcatccacacgaccgcggagagccac
aaccgcgtcatggtcgtcgaggtcatgggccggcacgccggctggatcgccgtgaacgcc
ggcatcgcgggcggggccgagctcgtgctcgcccccgaggagcccttcgacatggaccgc
atcgtcaagttcctcaagcaccgtcaccgctcgcacgcgaacttctcgatcgtcgtggtc
gccgagggtgcgctgcccaaggagggcagctcgatgcagtacgaggcccagctcggcaag
ttcggcgagatcattgccggtgccatcggcgagcgggtcgccaacgagatcgcgacccgg
accggcttcgacacgcgcctgacgatcctcggtcacgtccagcgcggcggcacgcccacg
ccgaccgaccgcatcctcggcagccgcttcggcgtcgcggccgtcgacgcgatcagccgc
ggcgagaccaacgtcatgacggccctgcgcaacgaagaggtcgtcctcgtcccgctcgag
gagatcgccgggaaggtcaagcacgtccccgacgacctcctcagggtcgcgcgcgtcctc
gcctga

DBGET integrated database retrieval system