KEGG   Sanguibacter keddieii: Sked_20730Help
Entry
Sked_20730        CDS       T01214                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ske  Sanguibacter keddieii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sked_20730
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sked_20730
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sked_20730
Enzymes [BR:ske01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sked_20730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2313858..2314676)
Genome map
AA seq 272 aa AA seqDB search
MSATARRIDDLKAEGRAALVGYLPTGFPTVDQSIEAARALVEAGADVIELGIPYSDPVMD
GPTIQEAVDHALRSGARVRDVFRVVEAVADLGAPVLVMTYFNPVLRYGVDAFARDLAAAG
GAGLITPDLVPDEAAEWIEAADSRDLDKVFLVAPSSTPERLAMTSAASRGFVYAASTMGV
TGERATVGARAEELVAATRAAGAERVCVGLGVSRPEQAAEVGRYADGVIVGSAFVKPLLG
DAPFADRLTQMQSVVSGIAAGVRSARTGAVSS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgacagcacgacggatcgacgacctcaaggccgaggggcgggcggccctcgtc
ggctacctgcctaccgggttccccacggtcgaccagtcgatcgaggccgcacgggcgctc
gtcgaggccggcgcggacgtcatcgagctcggcatcccgtacagcgacccggtgatggac
gggcccaccatccaggaggccgtcgaccacgccctccgctcgggtgcgcgggtccgcgac
gtgttccgcgtcgtcgaggccgtcgccgacctcggcgcgccggtgctggtcatgacgtac
ttcaacccggtcctgcggtacggcgtcgacgccttcgcccgcgacctcgcggccgccggc
ggtgcgggtctcatcacgccggacctcgtccccgacgaggctgccgagtggatcgaggcg
gcggactcccgcgacctcgacaaggtgttcctcgtggcgccgagctcgacccccgagcgt
ctcgcgatgacctccgcagcctcccgcggttttgtctacgccgcgtcgaccatgggtgtc
accggagagcgtgccacggtcggcgcgcgggccgaggagctcgtcgccgcgacccgggcg
gcgggcgcagagcgcgtctgcgtcggcctcggtgtgtcgcggcccgagcaggccgcggag
gtgggccggtacgccgacggcgtcatcgtcggctcggccttcgtcaagcccctgctgggg
gacgcgccgttcgcggaccgcctcacgcagatgcagtcggtggtgtccggcatcgccgcg
ggcgtccgctcggcacggaccggggcggtgtcctcgtga

DBGET integrated database retrieval system