KEGG   Sanguibacter keddieii: Sked_20730Help
Entry
Sked_20730        CDS       T01214                                 

Definition
tryptophan synthase, alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ske  Sanguibacter keddieii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sked_20730
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sked_20730
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sked_20730
Enzymes [BR:ske01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sked_20730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2313858..2314676)
Genome map
AA seq 272 aa AA seqDB search
MSATARRIDDLKAEGRAALVGYLPTGFPTVDQSIEAARALVEAGADVIELGIPYSDPVMD
GPTIQEAVDHALRSGARVRDVFRVVEAVADLGAPVLVMTYFNPVLRYGVDAFARDLAAAG
GAGLITPDLVPDEAAEWIEAADSRDLDKVFLVAPSSTPERLAMTSAASRGFVYAASTMGV
TGERATVGARAEELVAATRAAGAERVCVGLGVSRPEQAAEVGRYADGVIVGSAFVKPLLG
DAPFADRLTQMQSVVSGIAAGVRSARTGAVSS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgacagcacgacggatcgacgacctcaaggccgaggggcgggcggccctcgtc
ggctacctgcctaccgggttccccacggtcgaccagtcgatcgaggccgcacgggcgctc
gtcgaggccggcgcggacgtcatcgagctcggcatcccgtacagcgacccggtgatggac
gggcccaccatccaggaggccgtcgaccacgccctccgctcgggtgcgcgggtccgcgac
gtgttccgcgtcgtcgaggccgtcgccgacctcggcgcgccggtgctggtcatgacgtac
ttcaacccggtcctgcggtacggcgtcgacgccttcgcccgcgacctcgcggccgccggc
ggtgcgggtctcatcacgccggacctcgtccccgacgaggctgccgagtggatcgaggcg
gcggactcccgcgacctcgacaaggtgttcctcgtggcgccgagctcgacccccgagcgt
ctcgcgatgacctccgcagcctcccgcggttttgtctacgccgcgtcgaccatgggtgtc
accggagagcgtgccacggtcggcgcgcgggccgaggagctcgtcgccgcgacccgggcg
gcgggcgcagagcgcgtctgcgtcggcctcggtgtgtcgcggcccgagcaggccgcggag
gtgggccggtacgccgacggcgtcatcgtcggctcggccttcgtcaagcccctgctgggg
gacgcgccgttcgcggaccgcctcacgcagatgcagtcggtggtgtccggcatcgccgcg
ggcgtccgctcggcacggaccggggcggtgtcctcgtga

DBGET integrated database retrieval system