KEGG   Sanguibacter keddieii: Sked_20740Help
Entry
Sked_20740        CDS       T01214                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ske  Sanguibacter keddieii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sked_20740
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sked_20740
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sked_20740
Enzymes [BR:ske01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sked_20740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2314673..2315920)
Genome map
AA seq 415 aa AA seqDB search
MPESLQNLSGPYFGEFGGRYVPEALIAALDELDVAYQAAVADPVFQSQLAELHRSYSGRP
SIITEVPRFAEHAGGARVILKREDLNHTGSHKINNVLGQALLTKRIGKKRVIAETGAGQH
GVATATAAALFDLECVVYMGEEDTQRQALNVARMRLLGAEVIPVTTGSRTLKDAINEALR
DWVTNVDSTNYVFGTAAGPHPFPAMVRDFQRIIGVEARQQVLDLVGRLPDVVAACVGGGS
NAIGIFDAFLDDESVRLVGLEAGGDGVETGRHASSITGGATGVLHGARSYLLQDEDGQTK
DSHSISAGLDYPGVGPQHSYLSSIGRAEYQPVTDTEAMEALRLLCRTEGIIPAIESAHAL
AGAMRLGREAAEQGRTDEVILVNLSGRGDKDVATAARWFELVDADADLGAEGADA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagtccctgcagaacctgtccggcccgtacttcggcgagttcggcggccggtac
gtccccgaggcgctgatcgccgccctcgacgagctcgacgtggcgtaccaggcggcggtc
gccgacccggtgttccagtcgcagctcgccgagctgcaccggtcctacagcggtcgaccg
agcatcatcacggaggtgccgcgcttcgccgagcacgccgggggtgcccgcgtgatcctc
aagcgcgaggacctcaaccacaccgggtcgcacaagatcaacaacgtgctcggccaggcg
ctgctcaccaagcgcatcggcaagaagcgcgtcatcgcggagaccggcgccggtcagcac
ggtgtcgccacggcgacggcggcagccctgttcgacctcgagtgcgtcgtgtacatgggc
gaggaggacacgcagcgccaggcgctcaacgtcgcccggatgcgtctgctcggcgccgag
gtcatcccggtgaccaccgggtcgcgcacgctcaaggacgcgatcaacgaggctctccgc
gactgggtcaccaacgtcgactcgaccaactacgtcttcggcacggccgcgggcccccac
ccgttccccgcgatggtgcgcgacttccagcggatcatcggcgtcgaggcgcgccagcag
gtcctcgacctggtcggccggctgcccgacgtcgtcgcagcgtgcgtcggcggaggctcc
aacgcgatcggcatcttcgacgccttcctcgacgacgagtcggtccggctcgtcggcctc
gaggccggcggtgacggtgtcgagaccgggcgtcacgcctcgagcatcacgggaggcgcc
accggcgtgctgcacggcgcgcgctcgtacctgctgcaggacgaggacggccagaccaag
gacagccactcgatctcggcgggtctggactacccgggcgtcggcccccagcactcgtac
ctgtcgagcatcggtcgcgccgagtaccagccggtgaccgacaccgaggccatggaggcc
ctgcgcctgctgtgccgtaccgagggcatcatcccggccatcgagtcggcgcacgccctc
gccggtgcgatgcgcctgggccgcgaggccgcggagcaggggcgcaccgacgaggtcatc
ctggtgaacctctcggggcgcggggacaaggacgtcgcgaccgcggcgcgctggttcgag
ctggtcgacgcggacgccgacctcggtgcagaaggagcagacgcgtga

DBGET integrated database retrieval system