KEGG   Sanguibacter keddieii: Sked_20750Help
Entry
Sked_20750        CDS       T01214                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ske  Sanguibacter keddieii
Pathway
ske00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01130  Biosynthesis of antibiotics
ske01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sked_20750
Enzymes [BR:ske01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sked_20750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth DUF3509 DHO_dh
Motif
Other DBs
NCBI-ProteinID: ACZ21997
UniProt: D1BHS7
Position
complement(2316081..2316893)
Genome map
AA seq 270 aa AA seqDB search
MTVLDDIIAGVREDLAVREAATPLSVLKEKAQRQTNALECVSRLSGEDAVAVIAEVKRSS
PSKGALASIDDPAALAREYEKGGASVISVLTEQRRFGGSLDDLRAVRAAVDIPVLRKDFV
VTPYQVWEARAWGADLVLLIVAALEQTVLESLLDRVHSLGMTALVEVHTVDEVTRAVDAG
ARLVGVNARNLKTLEVDRTTFARLAPAVPEGIVRIAESGVRGPHDVMDYARSGAHAVLVG
EALVTGESPRSSVADLVAAGSHPSLRAVRH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctcgacgacatcatcgccggggtgcgtgaagacctcgcggtgcgcgaggcg
gccacgccgctctcggtgctcaaggagaaggcccagcgccagacgaacgccctcgagtgc
gtcagccgcctcagcggcgaggacgccgtggccgtgatcgccgaggtgaagcgctcgagc
ccgagcaagggtgcgctcgcctcgatcgacgaccctgcggcgctcgcccgcgagtacgag
aagggcggcgcgtccgtcatctcggtgctcaccgagcagcggcgcttcggcggcagcctg
gacgacctgcgcgcggtccgcgcggcggtcgacatccccgtgctccgcaaggacttcgtg
gtcacgccctaccaggtgtgggaggcccgcgcctggggcgccgacctcgtgctgctcatc
gtcgcggccctcgagcagaccgtgctcgagtcgctcctcgaccgcgtgcactcgctcggc
atgacggccctcgtcgaggtgcacaccgtcgacgaggtgacccgcgcggtcgacgccggg
gcgcgcctcgtcggcgtcaacgcccgcaacctcaagaccctcgaggtcgaccgcacgacc
ttcgcgcgtctcgccccggcggtccccgaggggatcgtgcggatcgccgagtcgggtgtc
cgcggcccccacgacgtcatggactacgcccgctccggcgcgcacgccgtgctcgtcggc
gaggcgctcgtgacgggggagtccccgcgctcctcggtcgccgacctggtcgccgccggg
tcccacccctcgctccgggcagtccgccactag

DBGET integrated database retrieval system