KEGG   Sanguibacter keddieii: Sked_22010Help
Entry
Sked_22010        CDS       T01214                                 

Definition
(GenBank) aldose 1-epimerase-like enzyme
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ske  Sanguibacter keddieii
Pathway
ske00010  Glycolysis / Gluconeogenesis
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01120  Microbial metabolism in diverse environments
ske01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_22010
Enzymes [BR:ske01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Sked_22010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACZ22120
UniProt: D1BIE3
Position
complement(2446580..2447482)
Genome map
AA seq 300 aa AA seqDB search
MTTDSTAPALPPTVTSRTTPAGLEVLTVANAHGTAEVYLQGAHVTAWTPAGEDPVLWLSS
ASAFEPGVPVRGGIPICFPWFGARDGHPEAPAHGYARRTVWTLVGAHDDHETTVLRLALA
APADPALADLSGLDALYEVRVGRTLDVALTVTSTRDVPVRFEEAQHTYLRVLDVEATAVH
GLEEVAYLDKTAAAGTDPHRTPEGAPLVPSGQVDRVYLGTSGPVQVVDAARTVRVTKSSS
QSTVVWSPGAEVAAGMRDMGPGEWREMVCVESANVGEHAVVLEPGRPHTLGSSYEVLPRV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacggacagcacagcccccgcgctcccgccgacggtgacgtcgaggacgacgccc
gccggcctggaggtgctcaccgtcgccaacgcccacggcaccgcagaggtctacctccag
ggggcgcacgtcacggcgtggaccccggccggcgaggaccccgtgctgtggctgagctcg
gcgagcgccttcgagcccggcgtcccggtccgtggcggcatcccgatctgcttcccgtgg
ttcggtgcccgggacggccatcctgaggctccggcccacggctacgcccggcgcacggtg
tggacgctcgtcggcgctcacgacgaccacgagaccaccgtgctccgtctcgcgctcgcg
gccccggccgaccccgcgctcgcggacctctccggactcgacgccctctacgaggtgcgc
gtcgggcggacgctcgacgtcgcgctcacggtgacgagcacccgggacgtgccggtgcgc
ttcgaggaggcgcagcacacctacctgcgcgtgctcgacgtcgaggcgaccgcggtgcac
ggcctcgaggaggtcgcctacctcgacaagacggccgctgccgggacggacccgcaccgc
actcctgagggggcgccgctcgtgccgagcggccaggtcgaccgggtgtacctcgggacg
tcgggtccggtgcaggtggtggacgcggcgcggaccgtccgggtcacgaagagctcgtcg
cagagcaccgtggtgtggtctccgggtgccgaggtcgcggcgggcatgcgggacatgggc
ccgggggagtggcgcgagatggtctgcgtcgagtccgcgaacgtcggggagcacgccgtg
gtgctcgagcctggtcgtccccacaccctcggctcctcctacgaggtcctgccgcgggtg
tga

DBGET integrated database retrieval system