KEGG   Sanguibacter keddieii: Sked_22010Help
Entry
Sked_22010        CDS       T01214                                 

Definition
aldose 1-epimerase-like enzyme
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ske  Sanguibacter keddieii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ske00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2446580..2447482)
Genome map
AA seq 300 aa AA seqDB search
MTTDSTAPALPPTVTSRTTPAGLEVLTVANAHGTAEVYLQGAHVTAWTPAGEDPVLWLSS
ASAFEPGVPVRGGIPICFPWFGARDGHPEAPAHGYARRTVWTLVGAHDDHETTVLRLALA
APADPALADLSGLDALYEVRVGRTLDVALTVTSTRDVPVRFEEAQHTYLRVLDVEATAVH
GLEEVAYLDKTAAAGTDPHRTPEGAPLVPSGQVDRVYLGTSGPVQVVDAARTVRVTKSSS
QSTVVWSPGAEVAAGMRDMGPGEWREMVCVESANVGEHAVVLEPGRPHTLGSSYEVLPRV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacggacagcacagcccccgcgctcccgccgacggtgacgtcgaggacgacgccc
gccggcctggaggtgctcaccgtcgccaacgcccacggcaccgcagaggtctacctccag
ggggcgcacgtcacggcgtggaccccggccggcgaggaccccgtgctgtggctgagctcg
gcgagcgccttcgagcccggcgtcccggtccgtggcggcatcccgatctgcttcccgtgg
ttcggtgcccgggacggccatcctgaggctccggcccacggctacgcccggcgcacggtg
tggacgctcgtcggcgctcacgacgaccacgagaccaccgtgctccgtctcgcgctcgcg
gccccggccgaccccgcgctcgcggacctctccggactcgacgccctctacgaggtgcgc
gtcgggcggacgctcgacgtcgcgctcacggtgacgagcacccgggacgtgccggtgcgc
ttcgaggaggcgcagcacacctacctgcgcgtgctcgacgtcgaggcgaccgcggtgcac
ggcctcgaggaggtcgcctacctcgacaagacggccgctgccgggacggacccgcaccgc
actcctgagggggcgccgctcgtgccgagcggccaggtcgaccgggtgtacctcgggacg
tcgggtccggtgcaggtggtggacgcggcgcggaccgtccgggtcacgaagagctcgtcg
cagagcaccgtggtgtggtctccgggtgccgaggtcgcggcgggcatgcgggacatgggc
ccgggggagtggcgcgagatggtctgcgtcgagtccgcgaacgtcggggagcacgccgtg
gtgctcgagcctggtcgtccccacaccctcggctcctcctacgaggtcctgccgcgggtg
tga

DBGET integrated database retrieval system