KEGG   Sanguibacter keddieii: Sked_23300Help
Entry
Sked_23300        CDS       T01214                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ske  Sanguibacter keddieii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sked_23300
   00670 One carbon pool by folate
    Sked_23300
Enzymes [BR:ske01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sked_23300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2595466..2596014)
Genome map
AA seq 182 aa AA seqDB search
MPQPVPAQRVGLVWAQARDGVIGAGGTMPWHLPEDGAHFRRTTAGAAVVMGRATWDSLPE
RFRPLPGRTNVVLTRSPGLELTGAVVVGSLDEALAVAADAAPGRTWVMGGGEVYRQALAQ
ADLLVVTEIDTEVEGDTRAPEIGDGWDAEPVVGDSTDADGWSTSRTGLRFRFVEHRRTGT
TA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcagccggtccccgcgcagcgggtgggtctcgtctgggcgcaggcccgggacggt
gtcatcggcgccggggggaccatgccctggcacctccccgaggacggggcgcacttccgc
aggacgaccgcgggggcggccgtcgtcatggggcgcgccacgtgggactcgctccccgag
aggttccgtccgctccccgggcgcaccaacgtggtgctcacccggtcgccgggcctcgag
ctgaccggagcggtggtggtcgggtcgctcgacgaggcgctcgcggtcgccgccgacgcg
gccccgggccggacctgggtcatgggtggcggcgaggtctaccgccaggcgctggctcag
gccgacctgctggtcgtcaccgagatcgacacggaggtcgagggggacacccgggccccg
gagatcggcgacgggtgggacgcggaacccgtcgtgggtgactcgaccgacgcggacggg
tggtcgacctcgcggaccgggctgcggttcaggttcgtcgagcaccgcaggaccggcacg
accgcctga

DBGET integrated database retrieval system