KEGG   Sanguibacter keddieii: Sked_23540Help
Entry
Sked_23540        CDS       T01214                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ske  Sanguibacter keddieii
Pathway
ske00900  Terpenoid backbone biosynthesis
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01130  Biosynthesis of antibiotics
Module
ske_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sked_23540
Enzymes [BR:ske01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Sked_23540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Sacchrp_dh_NADP PHP
Motif
Other DBs
NCBI-ProteinID: ACZ22269
UniProt: D1BJ75
Position
complement(2622115..2623302)
Genome map
AA seq 395 aa AA seqDB search
MSSSSVRSVTLLGSTGSIGTQAVDVLSRHRDRYRVTALSAGGAQPEMLAQQAVDLDVEVV
AVSDEAAVPALRDHLSRLQTPGSRAIEVLSGPDAATTLAAGGSDVVLNGITGSVGLGPTL
AALRSGSTLALANKESLVVGGPLVQAARVRPDQIVPVDSEHSAMAQSLRSGARHEVRRLV
LTASGGPFRGWHRDDVKAVTVDQALDHPTWSMGPVVTINSATLVNKGLELIEAHLLFDVP
VDDITVVVHPQSVVHSMVEFHDGSTIAQASPPDMRLPIALGLSWPERLDDVSTPCDWSRP
VAWTFEPLDETLFGAVRLARQVAAAGATHPAVFNAANEECVAAFLEGRIGFLEIVETVER
VVAEHESSSGVLTLDDVLAAETWARGRAREVLAER
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgagtagcagcgtccgctcggtcaccctcctcgggtcgacggggtccatcgggacc
caggccgtcgacgtcctctcccggcaccgcgacaggtaccgggtgacagcgctctcggcc
ggtggggcgcagcccgagatgctcgcccagcaggccgtcgacctcgacgtcgaggtcgtg
gcggtgtctgacgaggcggcggtaccggcgctccgcgaccacctctcgcgcctgcagacc
ccaggctctcgcgcgatcgaggtcctctccggcccggacgccgcgaccacgctcgccgcg
ggcggctcggacgtcgtgctcaacgggatcaccggctcggtcggcctcgggccgacgctg
gccgcgctgcggtcgggatcgaccctcgcgctcgccaacaaggagtccctcgtggtcggg
gggccgctcgtccaggcggcgcgcgtgcgccccgaccagatcgtcccggtcgactccgag
cactcggcgatggcgcagagcctgcgctcgggtgcccgccacgaggtccgccggctcgtg
ctcaccgcgtcgggcggcccgttccgcggctggcaccgtgacgacgtcaaggccgtgacg
gtggaccaggcgctcgaccaccccacgtggtcgatggggccggtcgtcacgatcaactcg
gcgacgctggtcaacaaggggctcgagctcatcgaggcgcacctgctcttcgacgtcccg
gtcgacgacatcaccgtggtggtccacccgcagtccgtcgtgcactcgatggtcgagttc
cacgacgggtcgacgatcgcccaggcctcgccaccggacatgcggctgccgatcgcgctc
ggcctcagctggcccgagcgtctcgacgacgtgtcgacgccgtgcgactggtcgaggccc
gtcgcctggaccttcgagcctctcgacgagaccctcttcggtgccgtccggctcgccagg
caggtcgcagccgcgggtgccacccacccggcggtcttcaacgccgcgaacgaggagtgc
gtcgcagccttcctcgaggggcgcatcgggttcctcgagatcgtcgagaccgtcgagcgc
gtggtcgccgagcacgagtcgagcagcggtgtgctcaccctcgacgacgtgctcgcagcc
gagacgtgggcgcgcgggcgggcgcgcgaggtgctcgccgagcgctga

DBGET integrated database retrieval system