KEGG   Sanguibacter keddieii: Sked_24590Help
Entry
Sked_24590        CDS       T01214                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ske  Sanguibacter keddieii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sked_24590
Enzymes [BR:ske01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Sked_24590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2741222..2743378)
Genome map
AA seq 718 aa AA seqDB search
MDPSERATLSPALVDLAEAHGISHDHWGFHGEKKTAPASTLVAILAALGVDASTPEHIDV
ALATVVDDEWRRMLPATVVSRHGVAHRVPVHVTDGVDVEVWVELEDGTRVTLEQVDDYVE
PRTVDGRTIGRATFELPDDLPLGWHELRARTRDGQSRTVLAVTPDRLELPEHLVGSQHWG
LMAQFYSVRSRQSWGIGDFADLADIAWIGGQQLGADFLLVNPVAAAEPTTPMTPSPYLPV
SRRFVNPIYLRVEDIRETAYLSAADRSLVEWAADDVRELSTDPGPIDRDAVWDAKKSALR
VVFEAPRSAARQTAFVDFCRSQGSGLESFATWCAFTDHLGSGEWPEEYRTPGSEAVARLR
EELSDEVDFYSWLQWVADVQLEQAQRAARESGMGIGIMHDLAVGVHPRGADAWALAGVLA
QGMEVGAPPDMYNQQGQNWSQPPWHPRELARAGYAPYRDLIRTVFRHAGALRIDHVIGLF
RLWWIPQGSPADEGAYVRYDHEALIGILCLEAQRAGGVVIGEDLGVVEPWVRGYLTDRGV
LSTSVLWFEKDDDGRPMAPEDYRPLSLTTVTTHDLPPTAGYLAGEHVELRERLGLLTEPV
HQVRQDARREREQMVLALAARGLVGDDPSERELVEALHRYVLLTPATLLGVSLADAVGER
RAQNQPGTDQEYPNWKVPLGDSLGTVVLVDDLAENARLRSLAAVMNEGTGRTTEDVDS
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
gtggacccctctgagcgcgcgaccctctcacctgcacttgtcgacctcgccgaggctcac
gggatctcccacgaccactgggggttccacggcgagaagaagactgcgccggcctcgacg
ctcgtcgcgatcctcgccgccctcggggtcgacgcgtccacgcccgagcacatcgacgtc
gctctcgcgacagtcgtcgacgacgagtggcgccgcatgctccccgccaccgtcgtctcg
cgccacggggtcgcgcaccgcgtgccggtccacgtgacggacggcgtcgacgtcgaggtg
tgggtcgagctcgaggacggcacacgcgtcacgctcgagcaggtggacgactacgtcgag
ccccgcacggtcgacggccgcacgatcgggcgggcgaccttcgagctccccgacgacctc
ccgctcggctggcacgagctgcgtgcccgcacgcgcgacggccagtcccggaccgtgctc
gccgtgaccccggaccgtctcgagctccccgagcacctggtggggtcgcagcactggggc
ctcatggcccagttctactccgtccgctcccgccagtcctgggggatcggcgacttcgcc
gacctcgcggacatcgcgtggatcggcgggcagcagctcggcgccgacttcctgctggtc
aacccggtcgccgcggccgagccgacgacgccgatgacgccgtcgccctacctcccggtg
tcacggcgcttcgtcaacccgatctacctgcgggtcgaggacatccgcgagaccgcgtac
ctctctgctgccgacaggtcgctcgtcgagtgggctgcggacgacgtccgcgagctgagc
accgacccggggccgatcgaccgcgacgccgtgtgggacgcgaagaagagcgcgctgcgc
gtcgtcttcgaggcacctcgttcggccgcccgccagaccgccttcgtggacttctgccgg
tcgcagggcagcggcctcgagagcttcgcgacctggtgcgccttcaccgaccacctcggc
tcgggcgagtggcccgaggagtaccgcaccccgggctcggaggcagtggcccggctccgc
gaggagctctccgacgaggtcgacttctactcctggctccagtgggtcgccgacgtccag
ctcgagcaggcccagcgtgccgcccgcgagagcggcatgggcatcgggatcatgcacgac
ctcgcggtcggcgtgcacccccgcggggcggacgcctgggccctggcgggcgtgctcgcc
cagggcatggaggtgggcgcgccgccggacatgtacaatcagcagggccagaactggtcg
cagcccccgtggcacccgcgcgagctcgcacgtgcggggtacgccccgtaccgcgacctc
atccgcacggtgttccgtcacgcgggtgcgctgcgcatcgaccacgtcatcggtctgttc
cggctgtggtggatcccgcagggcagcccggccgacgagggcgcgtacgtccggtacgac
cacgaggcgctcatcggcatcctgtgcctcgaggcgcagcgtgccgggggcgtcgtcatc
ggagaggacctcggcgtcgtcgagccctgggtccgcggctacctcacggaccgcggcgtc
ctgagcacctccgtgctgtggttcgagaaggacgacgacgggcgcccgatggctccggag
gactaccgtccgctgtcgctgacgaccgtcaccacccacgacctcccgccgacggccggg
tacctggccggcgagcacgtcgagctgcgcgagcggctcggcctgctgaccgagcccgtg
caccaggtccgccaggacgcgcgccgtgagcgcgagcagatggtcctcgcgctcgccgcg
cggggtctcgtgggggacgacccgtccgagcgcgagctcgtcgaggcgctccaccggtac
gtgctcctcacgccggcgaccctgctcggtgtctcgctcgcggacgccgtcggcgagcgc
cgggcgcagaaccagcccgggacggaccaggagtacccgaactggaaggtgccgctcggc
gactccctcggcaccgtggtgctcgtcgacgacctcgcggagaacgcgcggctccgctcg
ctcgccgcggtgatgaacgagggcaccgggcggacgacggaggacgtcgactcctga

DBGET integrated database retrieval system