KEGG   Sanguibacter keddieii: Sked_25810Help
Entry
Sked_25810        CDS       T01214                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ske  Sanguibacter keddieii
Pathway
ske00020  Citrate cycle (TCA cycle)
ske00190  Oxidative phosphorylation
ske00650  Butanoate metabolism
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01120  Microbial metabolism in diverse environments
ske01130  Biosynthesis of antibiotics
ske01200  Carbon metabolism
Module
ske_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ske_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ske_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sked_25810
   00650 Butanoate metabolism
    Sked_25810
  Energy metabolism
   00190 Oxidative phosphorylation
    Sked_25810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF4018
Motif
Other DBs
NCBI-ProteinID: ACZ22485
UniProt: D1BKK8
Position
2867366..2867821
Genome map
AA seq 151 aa AA seqDB search
MTATAPTIADPREPYKRLRTTRSNFELYGWVFMRASGVILLVLIFGHLFVNLMVGDGVNA
IDFAFVGGKWASPFWQIWDLLMLWLGMMHGTNGVRTIVNDYAERPLVRLWLKVALYTAFV
AVTVLGTLVIFTFDPCPVDAPAELLASFCSA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccactgccccgaccatcgcggacccgcgcgagccctacaagcgcctgcggacc
acccggtccaacttcgagctctacggctgggtcttcatgcgtgcctccggcgtgatcctg
ctcgtcctcatcttcggccacctgttcgtcaacctcatggtcggcgacggcgtcaacgcg
atcgacttcgcgttcgtcggcggcaagtgggcctcgccgttctggcagatctgggacctg
ctcatgctgtggctcgggatgatgcacggcaccaacggtgtgcgcaccatcgtcaacgac
tacgccgagcgccccctcgtccggctgtggctcaaggtcgcgctctacacggccttcgtg
gcggtcaccgtgctcggcacgctcgtgatcttcaccttcgacccgtgcccggtcgacgcc
cccgccgagctgctcgcgtcgttctgctccgcgtag

DBGET integrated database retrieval system