KEGG   Sanguibacter keddieii: Sked_25810Help
Entry
Sked_25810        CDS       T01214                                 

Definition
succinate dehydrogenase subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ske  Sanguibacter keddieii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sked_25810
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sked_25810
   00650 Butanoate metabolism
    Sked_25810
  Energy metabolism
   00190 Oxidative phosphorylation
    Sked_25810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2867366..2867821
Genome map
AA seq 151 aa AA seqDB search
MTATAPTIADPREPYKRLRTTRSNFELYGWVFMRASGVILLVLIFGHLFVNLMVGDGVNA
IDFAFVGGKWASPFWQIWDLLMLWLGMMHGTNGVRTIVNDYAERPLVRLWLKVALYTAFV
AVTVLGTLVIFTFDPCPVDAPAELLASFCSA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccactgccccgaccatcgcggacccgcgcgagccctacaagcgcctgcggacc
acccggtccaacttcgagctctacggctgggtcttcatgcgtgcctccggcgtgatcctg
ctcgtcctcatcttcggccacctgttcgtcaacctcatggtcggcgacggcgtcaacgcg
atcgacttcgcgttcgtcggcggcaagtgggcctcgccgttctggcagatctgggacctg
ctcatgctgtggctcgggatgatgcacggcaccaacggtgtgcgcaccatcgtcaacgac
tacgccgagcgccccctcgtccggctgtggctcaaggtcgcgctctacacggccttcgtg
gcggtcaccgtgctcggcacgctcgtgatcttcaccttcgacccgtgcccggtcgacgcc
cccgccgagctgctcgcgtcgttctgctccgcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system