KEGG   Sanguibacter keddieii: Sked_25960Help
Entry
Sked_25960        CDS       T01214                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ske  Sanguibacter keddieii
Pathway
ske00300  Lysine biosynthesis
ske01100  Metabolic pathways
ske01120  Microbial metabolism in diverse environments
ske01230  Biosynthesis of amino acids
Module
ske_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sked_25960
Enzymes [BR:ske01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Sked_25960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACZ22500
UniProt: D1BKM3
Position
complement(2882110..2883189)
Genome map
AA seq 359 aa AA seqDB search
MLDLTGGVVELTRALCDIPSVSGDERAVADAVEAALSGLTHLEVVRDGDAVVARTTLGRA
ERVVVAGHLDTVPVADNLPVRVVGEGVHAELWGRGTVDMKGGVAVQLALAAELVEPTRDV
TWVFYDHEEVESSLNGLGRIVRTRPELLEGDFAVLCEPTAAGIEGGCNGTLRVEVRVPGE
AAHSARSWMGTNAIHGAAEVLTRLAAYEPASTEVEGLVFREGMNAVGVRGGIAGNVIPDE
CVVTVNFRFAPSRSLAEAEQHTRDLFEGFDVTVTDAAAGARPGLDAPLAVDFTEAVLEVT
GGAPAPKYGWTDVARFSELGVPAVNFGPGDPLLAHKDDEHCPASQIVLCYEALRTWLLR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgacctcaccggaggcgtggtcgagctcacccgggccctctgcgacatcccctcg
gtgagcggcgacgagcgtgccgtcgccgacgcggtggaggcggcgctctcgggcctcacg
cacctcgaggtcgtccgcgacggcgacgccgtggtcgcgcggaccacgctgggccgcgca
gagcgcgtggtcgtcgccgggcacctcgacacggtcccggtcgccgacaacctccccgtg
cgcgtcgtgggcgagggtgtccacgccgagctctggggacgggggaccgtcgacatgaag
ggcggcgtcgccgtccagctcgcgctggccgccgagctcgtggagccgacgcgcgacgtc
acctgggtgttctacgaccacgaggaggtcgagtcctccctcaacggtctcggccgcatc
gtccggacccgacccgagctgctcgagggcgacttcgccgtgctctgcgagcccacggcc
gcggggatcgagggcggctgcaacggcaccctgcgcgtcgaggtccgcgtccccggggag
gccgcgcactcggcgcgctcctggatggggaccaacgcgatccacggggcggccgaggtc
ctgacccggctcgccgcgtacgagccggcctcgaccgaggtcgaggggctcgtgttccgc
gagggcatgaacgccgtcggcgtgcgcggcggcatcgccgggaacgtcatcccggacgag
tgcgtcgtgaccgtgaacttccgcttcgcgccgtcgcgctcgctcgccgaggcggagcag
cacacgcgcgacctcttcgagggcttcgacgtcacggtcaccgacgcggcggccggggcc
cgccccgggctcgacgcgccgctcgccgtcgacttcaccgaggcggtgctcgaggtcacc
ggcggcgcccccgcccccaagtacggctggacggacgtggcgcgcttctccgagctcggc
gtccccgcggtgaacttcggccccggtgacccgctgctcgcccacaaggacgacgagcac
tgcccggcgtcgcagatcgtgctctgctacgaggcgctgcgcacctggctgctgcgctga

DBGET integrated database retrieval system