KEGG   Sanguibacter keddieii: Sked_26810Help
Entry
Sked_26810        CDS       T01214                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ske  Sanguibacter keddieii
Brite
Enzymes [BR:ske01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Sked_26810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2990365..2992065)
Genome map
AA seq 566 aa AA seqDB search
MAALTARRRVASTAVVGLLCALVGCSPSGSPSDEGTVVDLLQQDWEHVLGVVADGTGLRV
TATGRSIVEQDGGGGQPDPPVNLAGTHLVAPEDFTLRASFTDVTADATLVVYDSPPVIAD
EFRIEPAALHLTLRGDDLRIAVFDGSHPQDVTDPQPAHDEHVTVLDTSAPLSVHRSGDLL
EIASDGETVSSLPLGDVFDSGELWLGLSSEEGAFTVRSLVASAPSGASLATAGPVADDAE
PSPDGLQALAAGSRPDFLVGAAVALGPFVSDAEYASAVVGDFGALTPENAMKPQALSPRQ
GEYTFEEADALLDLAESAGIAVHGHTIAFTEAMPRWMRELPTGTEQERQESADALLDYVT
TVVMHFRGRLDSLDVVNEPFDLDQGTSLQENVWFRVFGPTYPAVVSQAVHAADPDVRQFI
NENGADVPGPRQDALLQLALDTNAQGGHIDGVGLQAHVYELDTDALSAGDLATTFASVED
AGLLVRISENDVTDSEGQAVQAEQYATVLAACLRSDTCVSYTTWGVDDTYDWWVDDDGAL
QQGHDLLLDDGEPTPASDALREVLAG
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctgaccgcgcggcgccgcgtggcgagcactgcggtcgtcggtcttctctgt
gccctggtgggctgcagcccgtcgggctcgccgtccgacgagggcaccgtcgtcgacctg
ctgcagcaggactgggagcacgtgctcggggtcgtcgcggacggcacaggtctgcgggtg
acggcgaccgggcggagcatcgtcgagcaggacggcgggggaggccagccagacccgccg
gtcaacctcgcggggacgcacctggtcgctccggaggacttcacgctccgcgcctcgttc
acggacgtgacagccgacgccaccctggtcgtctacgacagcccgccggtgatcgcggac
gagttccggatcgagcccgcggctctccacctcacgctccgtggcgacgacctccggatc
gccgtcttcgacggctcgcacccgcaggacgtgaccgacccgcagccggcccacgacgag
cacgtcacggtcctcgacacctcggcgccgctctccgtgcaccgttccggcgacctgctc
gagatcgcgagcgacggcgagacggtgtcgtcgctgcccctcggcgacgtcttcgactcc
ggtgagctctggctggggttgtcgagcgaggagggggccttcacggtccgctcgctcgtg
gcctctgcgccgagcggtgcgtccctggccaccgcgggtcccgtcgcggacgacgcggaa
ccgtctccggacggtctgcaggctctggccgccggctcccgcccggacttcctcgtcggc
gctgcggtagccctcggcccgttcgtctcggacgcggagtacgcgagcgccgtcgtgggc
gacttcggggcactcaccccggagaacgcgatgaagccgcaggcgctctccccgcggcag
ggcgagtacaccttcgaggaggctgacgccctcctcgacctcgcggagagcgcggggatc
gccgtgcacggccacaccatcgccttcaccgaggcgatgccgcggtggatgcgtgagctt
cccaccggcaccgagcaggagcgccaggagagcgccgacgccctgctcgactacgtgacc
accgtcgtcatgcacttccggggccggctcgactcgctcgacgtcgtcaacgaaccgttc
gacctcgaccaggggaccagcctgcaggagaacgtctggttccgtgtcttcgggccgacc
tacccggcggtcgtctcgcaggcggtgcacgccgcagacccggacgtcaggcagttcatc
aacgagaacggcgccgacgtgccgggtccccgacaggacgccctgctccagctcgccctc
gacacgaacgcgcagggtgggcacatcgacggcgtgggcctccaggctcacgtctacgag
ctcgacaccgacgccctctcggccggcgatctcgcgacgaccttcgccagcgtcgaggac
gccgggctgctcgtcaggatctccgagaacgacgtcacggacagcgagggccaggccgtc
caggcggagcagtacgccacggtgctcgccgcctgcctccgctcggacacctgcgtctcc
tacacgacgtggggagtggacgacacgtacgactggtgggtcgacgacgacggggccctc
cagcagggccacgacctcctgctcgacgacggagaaccgacgcctgcgtccgacgcgctg
agagaggtcctcgcgggctga

DBGET integrated database retrieval system