KEGG   Sanguibacter keddieii: Sked_28660Help
Entry
Sked_28660        CDS       T01214                                 

Definition
23S RNA-specific pseudouridylate synthase
Orthology
K06177  
tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
ske  Sanguibacter keddieii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3204250..3205161)
Genome map
AA seq 303 aa AA seqDB search
MRDGLNPVRLQLPHGAEAATVLAYLVARFPTDAERMREKVAAGEVVDEIGRSLGPDAPYV
GGTLVYLYRDAAPEPRVPFEIDVLHHDDDLLVIDKPHFLASTPRGAYVVESAVVRLRRDL
GLPEISPAHRLDRITAGVLVLTTRREVRGAYQQLFASRTIHKTYEAVARVDPRLDLPRTV
RSRIVKEHGTLVAQEVPGEPNAESRVSLAEVAPGAGDGGEALGRYVLEPHTGKTHQLRLH
MASLGLPILNDNFYPRFYDVAPDDYSAPLQLLARSISFTDPLSGEPRTFTSRRALGRWPG
TAA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggacggcctcaaccctgtccggctccagctgccgcacggcgccgaggccgcgacg
gtgctcgcgtacctggtcgcccgcttccccaccgacgcggagcggatgcgcgagaaggtc
gctgccggcgaggtggtcgacgagatcggccggtcgctcggtcccgacgccccgtacgtc
ggcgggactctcgtctacctgtaccgcgacgcggcaccggagccacgggtgcccttcgag
atcgacgtgctgcaccacgatgacgacctgctcgtcatcgacaagccgcacttcctcgcc
agcacgccccgaggggcctacgtggtcgagtctgcggtcgtgcggctgcggcgcgacctg
gggctgcccgagatcagcccggcgcaccggctggaccgcatcaccgccggggtgctggtc
ctgacgacccgacgcgaggtccggggtgcctaccagcagctcttcgcgagccgcacgatc
cacaagacctacgaggccgtggcgcgtgtggacccgcggctcgacctcccgcggaccgtc
cgcagccgcatcgtcaaggagcacgggacgctggtggcccaggaggtgccgggggagccc
aacgcggagagccgcgtcagcctcgccgaggtggccccgggtgcgggggacggtggcgag
gccctcggtcgctacgtgctcgagccgcacaccggcaagacgcaccagctgcggctgcac
atggcctcgctcggcctgccgatcctcaacgacaacttctacccgcggttctacgacgtg
gcgcccgacgactactcggcgccgctgcagctgctcgcgcggtccatcagcttcaccgac
ccgctgagcggcgagccccggaccttcaccagccgacgcgccctgggacgctggcccggc
acggctgcgtga

DBGET integrated database retrieval system