KEGG   Sanguibacter keddieii: Sked_30390Help
Entry
Sked_30390        CDS       T01214                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ske  Sanguibacter keddieii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Sked_30390
Enzymes [BR:ske01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Sked_30390
    3.5.1.-  
     Sked_30390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3381103..3381717
Genome map
AA seq 204 aa AA seqDB search
MSTDAAQSLPGQPGPAPRRALLVVDVQPTFCEGGALGVDGGDAVAHAVAGFAAAHRADYA
LVVTTQDWHVDPGEHFGDTPDYVDTWPPHGVAGTAEAELHPALADLAPDVSVKKGEYQAA
YSGFEGVDSEGRLLADVLREARVEAVDVVGIAESHCVKATALDALQLGLATRVFTDLTVP
VSPEQGFQARVDMAAAGVELVASA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagacgccgcgcagagcctgccgggacagcccggacccgcaccccgccgcgcg
ctgctggtagtcgacgtccagccgaccttctgcgagggcggcgccctcggggtcgacggc
ggcgacgcggtcgcgcacgccgtcgcaggcttcgccgccgcgcaccgcgccgactacgca
ctcgtcgtgacgacgcaggactggcacgtcgacccgggcgagcacttcggcgacaccccc
gactacgtcgacacctggccgccgcacggtgtcgccgggaccgccgaggccgagctgcac
ccggcgctcgcggacctcgcgcccgacgtctcggtgaagaagggcgagtaccaggccgcc
tactccggcttcgagggcgtcgacagcgaggggcgcctgctcgccgacgtgctccgcgag
gcgcgcgtcgaggcggtcgacgtcgtcgggatcgcggagtcgcactgcgtcaaggccacg
gcgctcgacgcgctccagctcgggctggcgacacgggtcttcaccgacctcaccgtcccg
gtgtcccccgagcagggctttcaggcccgcgtcgacatggccgcagccggcgtcgagctg
gtcgcctccgcctga

DBGET integrated database retrieval system