KEGG   Sanguibacter keddieii: Sked_31910Help
Entry
Sked_31910        CDS       T01214                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ske  Sanguibacter keddieii
Pathway
ske00010  Glycolysis / Gluconeogenesis
ske00260  Glycine, serine and threonine metabolism
ske00680  Methane metabolism
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01120  Microbial metabolism in diverse environments
ske01130  Biosynthesis of antibiotics
ske01200  Carbon metabolism
ske01230  Biosynthesis of amino acids
Module
ske_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ske_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_31910
  Energy metabolism
   00680 Methane metabolism
    Sked_31910
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sked_31910
Enzymes [BR:ske01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sked_31910
Membrane trafficking [BR:ske04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Sked_31910
Exosome [BR:ske04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sked_31910
  Exosomal proteins of melanoma cells
   Sked_31910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACZ23087
UniProt: D1BD83
Position
complement(3551435..3552190)
Genome map
AA seq 251 aa AA seqDB search
MRQDGPMTYTLVLLRHGESEWNAKNLFTGWVDVNLSEKGVEEAKRGGKLLTDAGILPDVV
HTSLLRRAITTANLALDAADRHWIPVKRSWRLNERHYGALQGKDKKQTLAEFGEEQFMLW
RRSFDVPPPAIELGSEFSQDTDPRYADAPVVATECLKDVLDRALPYWDGEVVSDLREGKT
VLVAAHGNSLRAIVKHLDGISDEDIAGLNIPTGIPLVYELDENFVPTVKGGTYLDPDAAA
AAVAAVANQGR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaggatggacccatgacatacacccttgtgctgctccgccacggcgagagcgag
tggaacgcgaagaacctgttcaccggctgggtggacgtgaacctgtccgagaagggcgtc
gaggaggccaagcgaggcgggaagctgctcaccgacgcgggcatcctccccgacgtcgtg
cacacctcgctgctgcgccgcgcgatcacgaccgcgaacctcgcgctcgacgccgccgac
cgccactggatcccggtcaagcgcagctggcgtctcaacgagcgccactacggtgcgctc
cagggcaaggacaagaagcagacgctcgccgagttcggcgaggagcagttcatgctgtgg
cgccggtccttcgacgtgccgccgcccgcgatcgagctcggctcggagttctcgcaggac
accgacccccggtacgccgacgcccccgtcgtggcgaccgagtgcctcaaggacgtcctc
gaccgcgccctcccgtactgggacggcgaggtcgtcagcgacctgcgcgagggcaagacc
gtcctcgtcgccgcgcacggcaactcgctgcgcgcgatcgtcaagcacctcgacggcatc
tccgacgaggacatcgcgggcctgaacatcccgaccggcatcccgctcgtctacgagctc
gacgagaacttcgtgccgaccgtcaagggtggcacctacctcgaccccgacgccgcggct
gccgcggtcgccgccgtcgcaaaccagggtcgctga

DBGET integrated database retrieval system