KEGG   Sanguibacter keddieii: Sked_31910Help
Entry
Sked_31910        CDS       T01214                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ske  Sanguibacter keddieii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sked_31910
   01230 Biosynthesis of amino acids
    Sked_31910
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_31910
  Energy metabolism
   00680 Methane metabolism
    Sked_31910
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sked_31910
Enzymes [BR:ske01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sked_31910
Exosome [BR:ske04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sked_31910
  Exosomal proteins of melanoma cells
   Sked_31910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3551435..3552190)
Genome map
AA seq 251 aa AA seqDB search
MRQDGPMTYTLVLLRHGESEWNAKNLFTGWVDVNLSEKGVEEAKRGGKLLTDAGILPDVV
HTSLLRRAITTANLALDAADRHWIPVKRSWRLNERHYGALQGKDKKQTLAEFGEEQFMLW
RRSFDVPPPAIELGSEFSQDTDPRYADAPVVATECLKDVLDRALPYWDGEVVSDLREGKT
VLVAAHGNSLRAIVKHLDGISDEDIAGLNIPTGIPLVYELDENFVPTVKGGTYLDPDAAA
AAVAAVANQGR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaggatggacccatgacatacacccttgtgctgctccgccacggcgagagcgag
tggaacgcgaagaacctgttcaccggctgggtggacgtgaacctgtccgagaagggcgtc
gaggaggccaagcgaggcgggaagctgctcaccgacgcgggcatcctccccgacgtcgtg
cacacctcgctgctgcgccgcgcgatcacgaccgcgaacctcgcgctcgacgccgccgac
cgccactggatcccggtcaagcgcagctggcgtctcaacgagcgccactacggtgcgctc
cagggcaaggacaagaagcagacgctcgccgagttcggcgaggagcagttcatgctgtgg
cgccggtccttcgacgtgccgccgcccgcgatcgagctcggctcggagttctcgcaggac
accgacccccggtacgccgacgcccccgtcgtggcgaccgagtgcctcaaggacgtcctc
gaccgcgccctcccgtactgggacggcgaggtcgtcagcgacctgcgcgagggcaagacc
gtcctcgtcgccgcgcacggcaactcgctgcgcgcgatcgtcaagcacctcgacggcatc
tccgacgaggacatcgcgggcctgaacatcccgaccggcatcccgctcgtctacgagctc
gacgagaacttcgtgccgaccgtcaagggtggcacctacctcgaccccgacgccgcggct
gccgcggtcgccgccgtcgcaaaccagggtcgctga

DBGET integrated database retrieval system