KEGG   Sanguibacter keddieii: Sked_36040Help
Entry
Sked_36040        CDS       T01214                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ske  Sanguibacter keddieii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sked_36040
Enzymes [BR:ske01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Sked_36040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4031975..4033570
Genome map
AA seq 531 aa AA seqDB search
MPASPDPQQPAALDVAGTSSPDGAEATSLVAAPAGGPSWHDAVVVGGGVAGLVAAHTLVT
EGLSPVVVEASATCGGYLARADVGPAGTPVVVDVGAESYASRSQAIGDLVAALGLEAVEP
SGLSAWGYVPVGARPDDSTAPSADSAGRAFPLPAAGVLGIPGRPWARDTRRAIGVLGALR
ASLDRVLPASRVDTSNLASLVRSRLGARVLERLVTPVAGGVHSTDPALLSVDAVAPGLLA
AYRRTGSLAAAVLSLRAQAPAGSAVRGLVGGMNQLVAALERSVEHGGQVRRGSGARRLRR
VEGAWEVVLSDGAVLRTDRVVVAVGGHAAVALLADHVDVRGAAPVRGTDIRLVTLLLRVP
GLSPAPRGTGVLVAPGSDVVAKGTTHASAKWPWLRARLDATLGEDAHVVRLSYGRGGASA
PAPVAAGTDAAAADAAFVEQAVRDVQALYAVRLATDDVLSSLVTRWDDALSPPTPEHRER
TSRLVDDVAGLGGGGQAAGPGLAVTGAWVAGTGLAAVVPHAQAAARSLGHS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgccagccccgacccgcagcagcctgctgcgctggacgtggcggggacgagcagc
cctgacggggcggaggcgaccagcctcgtagccgctcctgcgggcggaccgtcgtggcac
gacgccgtcgtcgtcggcggtggcgtcgcggggctcgtggccgcgcacacgctcgtgacc
gagggcctgtcgcccgtggtcgtcgaggcgtcggccacctgcggcggctacctcgcgcgg
gctgacgtggggcccgcgggcacgcccgtggtggtggacgtcggcgcggagtcctacgcc
tcgcgcagccaggcgatcggcgacctggtggcggccctcggcctcgaggccgtcgagccg
agcggcctgtcggcgtggggctacgtccccgtcggtgcacgtcccgacgacagcaccgcc
ccgtccgccgacagcgccgggcgagccttcccgctgcctgctgccggggtgctgggcatc
ccgggacgcccgtgggcacgggacacccggcgcgcgatcggcgttctcggtgcgctgcgc
gcgagcctggaccgggtgctgccggcgtcccgcgtcgacacgtccaacctcgcgtcgctg
gtccggtcgcgcctcggggcgcgggtgctcgagcggctcgtgacgcccgtggccggcggg
gtgcactcgacggacccggcgctgctgtcggtcgacgcggtcgccccgggcctgctcgcg
gcctatcggcggaccgggtcgctcgccgcagccgtcctgtcgctgcgcgcccaggcccct
gcgggctcggccgtgcgcggcctggtcggcggcatgaaccagctggtcgcggcgctcgag
cgatccgtcgagcacggcgggcaggtccgtcgcggctccggggcgcggagactgcgccgc
gtcgagggcgcctgggaggtcgtcctgtcggacggtgcggtcctgcgcaccgaccgggtg
gtcgtggcggtcggcggccacgctgctgtcgcgctcctcgccgaccacgtcgacgtgcgc
ggggccgccccggtccgaggtaccgacatccgcctggtgacgctgctgctgcgcgtgccc
ggcctgagcccggcgccccggggcacgggcgtgctggtcgccccgggctccgacgtcgtc
gcgaagggcaccacccacgcctcggccaagtggccgtggctgcgggcccggctcgacgcc
acgctgggcgaggacgcccacgtggtgcggctcagctacggacgcgggggtgcctcggcg
cccgccccggtcgccgccgggacggacgcggccgcggccgacgcggccttcgtggagcag
gctgtgcgcgacgtgcaggccctctacgcggtccgcctggccacggacgacgtgctgtcg
tcgctcgtgacgcgctgggacgacgccctctcgcccccgaccccggagcaccgcgagcgc
acgtcgcggctggtcgacgacgtcgcagggctcggtggcggaggtcaggcggccggtcct
ggcctcgcggtgaccggggcgtgggtggcgggcaccgggctcgcggccgtcgtcccgcac
gcgcaggctgctgcacgctcgctgggacattcctga

DBGET integrated database retrieval system