KEGG   Sanguibacter keddieii: Sked_36070Help
Entry
Sked_36070        CDS       T01214                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ske  Sanguibacter keddieii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ske00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4035828..4036814
Genome map
AA seq 328 aa AA seqDB search
MTRPRRLRATPALRALVAETRLHPRDLVLPLFVKEGITEPVEITSMPGVLHHSEESLAQA
VREAADAGLGGVMLFGVPEHRDATGSGADDPEGILNRGIRIAVEAAAGRLVVMADLCLDE
FTDHGHCGVLDAHGGVDNDATLERYVSMAVAQAQAGATVLGLSGMMDGQVFAVRSGLDQS
TANGGAGFPDTAILAYSAKYASAFYGPFRDAVESTLDGDRRTYQMDAANRREGGRETALD
LLEGADIVMVKPAMSYLDVLADVAEQSDVPVAAYQVSGEYAMIEAAAANGWIDRRGAILE
SVLGIKRAGADIVLTYWATEIAGWLGER
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcccccgccgcctgcgcgccacccctgcgctgcgcgccctcgtcgccgagacc
cgcctgcacccccgcgacctcgtgctgccgctgttcgtcaaggagggcatcaccgagccc
gtcgagatcacctccatgcccggagtgctccaccacagcgaggagtccctcgcccaggcc
gtgcgcgaggccgccgacgcgggcctcggcggcgtcatgctcttcggggtccccgagcac
cgcgacgcgaccggctccggggccgacgaccccgaggggatcctcaaccgcggcatccgc
atcgccgtcgaggccgccgccgggcgcctcgtggtcatggccgacctctgcctcgacgag
ttcaccgaccacggccactgcggcgtgctcgacgcgcacggcggcgtcgacaacgacgcg
acgctcgagcgctacgtctccatggcggtcgcccaggcccaggccggcgccaccgtcctc
gggctctccgggatgatggacggccaggtcttcgccgtgcgctccggcctcgaccagtcg
accgcgaacggcggggccgggttcccggacaccgcgatcctcgcgtactccgccaagtac
gcctcggccttctacgggccgttccgcgacgccgtcgagtcgacgctcgacggcgaccgc
cgcacgtaccagatggacgccgcgaaccgccgcgagggcgggcgcgagacggcgctcgac
ctcctcgagggcgccgacatcgtcatggtcaagccggccatgagctacctcgacgtcctc
gccgacgtcgccgagcagtccgacgtccccgtcgccgcctaccaggtttccggcgagtac
gcgatgatcgaggccgccgcggcgaacggctggatcgaccgccgcggcgcgatcctcgag
tccgtgctcggcatcaagcgggccggtgccgacatcgtcctcacctactgggccaccgag
atcgccgggtggctcggagagcgctga

DBGET integrated database retrieval system