KEGG   Saccoglossus kowalevskii (acorn worm): 100370298Help
Entry
100370298         CDS       T04123                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Brite
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100370298
Peptidases [BR:sko01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100370298
Exosome [BR:sko04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100370298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 380 aa AA seqDB search
MRSRSTAKTTNAGGENKNAQTVTGKEKKMAKGKPRRHTRSFLGTLLKVLKYFILFVFVFY
LSFPFLLNIFPVVPRELTFLSKVRWPYFVDFNHPENYNVTGGRNIHIKSTDDVTLGIWQI
LPKSLLESSQEKTSEYYEKALSDGKHVILYFHGNSGNRARDHRVELYNVLSGINYHIIAF
DYRGYGDSNGTSNAVGILQDAEVMYKWLKPRIGKAKLYLYGHSLGTAVATALSRELCDAG
ECPSGLILESPFTDLIDEARNHPLSRFWKFWPGFDQMFLNAFLESAIPFNSTENIDYVKC
KILIMHAKDDLVVPFILGEKLAQHAGKNRPAGAGALKFLAFRADKGYGHKHLVRATELPK
IISDFIENARDEGQPANTKP
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcaagaagtacggcgaaaactaccaatgcaggtggtgaaaacaaaaatgcacaa
actgtgaccggcaaagaaaagaaaatggcgaagggaaagccccgaaggcacacacgtagt
ttcttaggaacactgttaaaagttttaaaatactttatactatttgtatttgtattttat
ctgtcgttcccatttttgttaaacatatttccagttgtcccacgagaacttacttttctc
agcaaagtgagatggccgtattttgtggattttaatcatcctgaaaactataatgtaact
ggagggagaaatattcacataaaatcaacagatgatgtgacacttggaatttggcaaata
ttaccaaagagtcttctagaaagcagtcaggaaaaaacatctgaatattatgaaaaagct
ttatctgatggtaaacatgttattctctatttccatggtaactcgggaaaccgggcgaga
gatcatcgtgtggaactttataatgttctgtctggaattaattaccacatcatagctttt
gattatagaggttatggtgattccaacggcacatcaaatgcagtaggtatcttacaagat
gcagaggtgatgtataaatggctaaaaccaagaattggaaaagcaaaattgtacctgtat
ggacattcactaggaacggcggttgctacagcattatcaagagagttatgtgatgcaggt
gaatgccctagtggtttaatattggaatctccatttactgatcttattgatgaagccagg
aatcatccattgtcaaggttttggaagttttggccaggttttgatcagatgtttttgaat
gcattcctagagtctgcaattcctttcaactctactgaaaatattgattatgtaaagtgc
aaaatattaattatgcatgctaaggatgaccttgttgtgcctttcattctaggagaaaag
ttagcacaacatgctggaaaaaatcgcccggctggagctggtgctttgaagtttttagca
ttccgggctgacaaaggttatggacacaaacacttagtgcgagctactgagttgcccaaa
atcattagtgattttatagaaaatgctcgagatgagggccagccagccaacacaaaacca
taa

DBGET integrated database retrieval system