KEGG   Saccoglossus kowalevskii (acorn worm): 102807223Help
Entry
102807223         CDS       T04123                                 

Definition
(RefSeq) monoacylglycerol lipase abhd6-A-like
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Brite
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102807223
Peptidases [BR:sko01002]
 Serine Peptidases
  Family S33
   102807223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 319 aa AA seqDB search
MMSFVITILFGVMLLLIMTAFYLYYINPQIIHWMFTRIMLYRAGLCVKYLYIGDYRYCYA
EKGNGTSNKPTMLFLHGFSSSKDMYCTVVTALAKDLHIILLDMPGHGYTTQKVKDDHSFL
AQANKVHQFVEAYGLDKSAFHLCGTSMGGAVAGIYAALYPHHLVKLTLVCPAGILTRKLS
KYVEILRDDEVDLLRPDSAEGLEKMLDIVMHKKLKIPNWYLKIANAIRKPHSEFYMLLME
EMKSESARNALKEKLKDIRTETQVIWGVCDEIIDVSGANVIKEALGDLCRVDLLDNCGHS
VELERPYRTAKVMMEFVNS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcattcgtaattaccatactatttggagtgatgcttctacttattatgactgca
ttttatctttattacatcaatccacaaataattcattggatgtttacacggataatgtta
tacagggctggtttatgtgtgaagtacctatatatcggagactatcgatactgttatgct
gaaaaggggaatggaacaagtaataaaccaacaatgttgttccttcacggtttctcatcg
tccaaagatatgtactgtactgttgttacggcattggccaaagatctgcacataattcta
ttagacatgcctggtcatggatacacaacacagaaagtcaaagatgatcactcgtttcta
gcacaagcaaacaaagtacaccagtttgtagaggcttatggtttggacaaatctgcattt
catctctgtggtacttcaatgggtggtgcagtagcaggaatatatgctgcattatatcca
catcatttggtcaaattaacgttggtttgtcctgcaggaattctcactcgtaaacttagt
aaatacgttgaaatcctaagagatgatgaagtagatctattaagaccagactcagcagaa
ggcttagaaaaaatgttggatattgtaatgcataaaaaactgaagataccaaattggtat
ttgaagattgccaacgctattagaaaacctcatagtgaattttatatgcttttaatggaa
gaaatgaaaagtgaatctgcacgaaatgctctgaaagaaaagttaaaagatattaggact
gaaacccaagtaatttggggtgtctgtgatgagattattgatgtttccggggcaaatgtg
atcaaagaagcactgggagatttgtgtcgagttgatcttttagacaattgtggccactct
gttgaattagaacgaccttatcgtacagccaaagttatgatggagtttgttaatagttga

DBGET integrated database retrieval system