KEGG   Sulfuricurvum kujiense: Sulku_0241Help
Entry
Sulku_0241        CDS       T01370                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00230  Purine metabolism
sku01100  Metabolic pathways
Module
sku_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sulku_0241
Enzymes [BR:sku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sulku_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase AAA_16 CPT MMR_HSR1 AAA_18 ABC_tran AAA_22 AAA_33 AAA_5 AAA_PrkA AAA_29 Cytidylate_kin Rad17 Zeta_toxin AAA_17 KAP_NTPase Flagellar_rod NACHT RNA_helicase TsaE AAA_30
Motif
Other DBs
NCBI-ProteinID: ADR32908
UniProt: E4TXZ5
Position
229944..230564
Genome map
AA seq 206 aa AA seqDB search
MNRQSGAILVLSGPSGAGKSSLIQKIKDQIGPIYFSISTTTRPIREGEVDGVHYYFVGVE
EFKRDIEDEMFLEYAVVHGNYYGTSLGPVKKALKEGKLVIFDIDVQGHDAVQNRLSDITT
SVFITTPSLEELKRRLYNRSTDSEEVILGRIEMAKREVQRISEYDFLIVNDNLEEAAEIL
VSIAKAARMKIPTFQINEFVQTWEAS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcaaagcggagcgatactcgttttatcagggccaagcggcgccggcaaaagt
tcattgattcagaaaattaaagatcagatcggtccaatctatttttcgatttcaacgacg
acacgccctatccgagaaggtgaagtggacggtgttcactattatttcgtgggtgtagaa
gagtttaagcgcgatatagaagatgagatgtttttggaatatgcagtcgttcacggcaat
tattacggaacatcgttaggaccggttaaaaaagcgcttaaagaaggaaaactcgttatt
tttgatatcgacgtgcaggggcacgacgcggtacaaaatcggctaagcgacattacaaca
tcggtctttattaccaccccttcactggaagagttaaaacgacggttgtataaccgttct
accgacagcgaagaggtcatcctcggacgtattgaaatggcaaaacgggaagttcagcgg
attagcgaatatgattttttaatcgtcaatgacaaccttgaagaagcggcggaaattttg
gtttccatagcaaaagcggcacggatgaagataccgacatttcaaattaatgaatttgtt
caaacctgggaagcctcgtaa

DBGET integrated database retrieval system