KEGG   Sulfuricurvum kujiense: Sulku_0289Help
Entry
Sulku_0289        CDS       T01370                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00010  Glycolysis / Gluconeogenesis
sku00051  Fructose and mannose metabolism
sku00562  Inositol phosphate metabolism
sku01100  Metabolic pathways
sku01110  Biosynthesis of secondary metabolites
sku01120  Microbial metabolism in diverse environments
sku01130  Biosynthesis of antibiotics
sku01200  Carbon metabolism
sku01230  Biosynthesis of amino acids
Module
sku_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sku_M00002  Glycolysis, core module involving three-carbon compounds
sku_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulku_0289
   00051 Fructose and mannose metabolism
    Sulku_0289
   00562 Inositol phosphate metabolism
    Sulku_0289
Enzymes [BR:sku01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sulku_0289
Exosome [BR:sku04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sulku_0289
  Exosomal proteins of bladder cancer cells
   Sulku_0289
  Exosomal proteins of melanoma cells
   Sulku_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADR32956
UniProt: E4TYH9
Position
279853..280572
Genome map
AA seq 239 aa AA seqDB search
MILCANFKANKTRQETRAYMAVVESFVSANDITDTIIVFPPFTALEHDPRNVLIGVQNGY
PVKNGAFTGEIALEQLEEFGIKTILIGHSERRHILGETQEQIAAKFRFFAEQGFLIVYCV
GEPLEIREQGHEALMAYIEKQFEGIDLTYSDLVLAYEPVWAIGTGLTPSNSDIELLHGAL
RMKTTAPLLYGGSVKVDNAGEIMALENVDGVLVGSAALSANDFCDMIAQAVELNTEKGE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatattgtgtgccaactttaaagcgaacaaaacacgtcaagagacacgtgcctatatg
gctgtagtagagtcatttgtaagtgcaaacgatatcaccgatacgattatcgtatttcct
ccgtttacggcattggagcatgatccccgcaacgtattgatcggagtccaaaacggctat
ccggtaaaaaacggcgcctttaccggagagatagcattggagcagctcgaagagttcgga
atcaagacgattctgatcggtcactccgaacgccgtcatatcctcggtgagacgcaagag
cagatagcggctaaattccggttttttgccgaacagggatttttgatcgtttactgtgtc
ggtgaacctttagagattagagaacagggacatgaagctctcatggcctatatagaaaag
cagtttgaagggattgatctgacctattcggatctggttcttgcctatgaaccggtatgg
gctatcggtacggggctgaccccttcaaatagcgatatagagcttttacacggagcgtta
agaatgaaaacgactgcgcctcttttatacggggggagtgtcaaagtggacaatgcgggt
gaaattatggccttggaaaacgttgacggcgttcttgtaggctcagcggcactcagtgcc
aacgatttttgcgatatgatcgcacaagcagtggaattaaacacagaaaaaggagaataa

DBGET integrated database retrieval system