KEGG   Sulfuricurvum kujiense: Sulku_0289Help
Entry
Sulku_0289        CDS       T01370                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulku_0289
   01230 Biosynthesis of amino acids
    Sulku_0289
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulku_0289
   00051 Fructose and mannose metabolism
    Sulku_0289
   00562 Inositol phosphate metabolism
    Sulku_0289
Enzymes [BR:sku01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sulku_0289
Exosome [BR:sku04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sulku_0289
  Exosomal proteins of bladder cancer cells
   Sulku_0289
  Exosomal proteins of melanoma cells
   Sulku_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
279853..280572
Genome map
AA seq 239 aa AA seqDB search
MILCANFKANKTRQETRAYMAVVESFVSANDITDTIIVFPPFTALEHDPRNVLIGVQNGY
PVKNGAFTGEIALEQLEEFGIKTILIGHSERRHILGETQEQIAAKFRFFAEQGFLIVYCV
GEPLEIREQGHEALMAYIEKQFEGIDLTYSDLVLAYEPVWAIGTGLTPSNSDIELLHGAL
RMKTTAPLLYGGSVKVDNAGEIMALENVDGVLVGSAALSANDFCDMIAQAVELNTEKGE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatattgtgtgccaactttaaagcgaacaaaacacgtcaagagacacgtgcctatatg
gctgtagtagagtcatttgtaagtgcaaacgatatcaccgatacgattatcgtatttcct
ccgtttacggcattggagcatgatccccgcaacgtattgatcggagtccaaaacggctat
ccggtaaaaaacggcgcctttaccggagagatagcattggagcagctcgaagagttcgga
atcaagacgattctgatcggtcactccgaacgccgtcatatcctcggtgagacgcaagag
cagatagcggctaaattccggttttttgccgaacagggatttttgatcgtttactgtgtc
ggtgaacctttagagattagagaacagggacatgaagctctcatggcctatatagaaaag
cagtttgaagggattgatctgacctattcggatctggttcttgcctatgaaccggtatgg
gctatcggtacggggctgaccccttcaaatagcgatatagagcttttacacggagcgtta
agaatgaaaacgactgcgcctcttttatacggggggagtgtcaaagtggacaatgcgggt
gaaattatggccttggaaaacgttgacggcgttcttgtaggctcagcggcactcagtgcc
aacgatttttgcgatatgatcgcacaagcagtggaattaaacacagaaaaaggagaataa

DBGET integrated database retrieval system