KEGG   Sulfuricurvum kujiense: Sulku_0332Help
Entry
Sulku_0332        CDS       T01370                                 

Definition
uroporphyrinogen III synthase hem4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sku  Sulfuricurvum kujiense
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sulku_0332
Enzymes [BR:sku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sulku_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
327822..328463
Genome map
AA seq 213 aa AA seqDB search
MRPIYLISKTPYEGVIHIPILTIRFLSPDINFSDYEGVVFTSKQGVLSLQNYLPDWNRLK
CICVSESTAKNAREAGAIDVEVANGYGDSIPDILGAKKRRGKWLYLRPKVVASDWVESAR
HRGITIDEAIVYESVCNEEMSNFPVSQEGVLIFTSPSAIRCFLQNHKILPTHDVIVIGET
TKNALPAGTLSYLSEVPSIEATVDLARQIAVEG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtcccatctacctgatctctaaaactccctacgagggagtgattcatatccctatc
ctcactatccgttttttatctcccgacatcaatttttccgactatgaaggggttgttttt
acctcaaagcagggagtcttgtcgctccaaaactatctacccgactggaatagactcaaa
tgcatttgtgtctcggaatcgaccgcgaaaaatgcccgtgaagccggggcgattgatgtg
gaagtcgcgaatggatacggagactctatccccgatattttaggtgcgaaaaaacggagg
gggaaatggctctacctccgacctaaagtagttgcgtctgattgggtcgagagtgcacgt
catagaggaatcacgatagatgaagcgattgtttatgaatctgtttgtaacgaagaaatg
agtaattttccggtatcacaagagggggtattaatttttacttccccctcagccattcga
tgttttctacaaaatcataagatacttccgacccatgatgtcattgtcatcggggaaacg
actaaaaatgcccttcctgcaggtacgttatcgtatcttagtgaggttccgagtattgaa
gctaccgtcgatttggcacgtcaaatcgctgtagagggataa

DBGET integrated database retrieval system