KEGG   Sulfuricurvum kujiense: Sulku_0474Help
Entry
Sulku_0474        CDS       T01370                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sku  Sulfuricurvum kujiense
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sulku_0474
Enzymes [BR:sku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Sulku_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
458509..459033
Genome map
AA seq 174 aa AA seqDB search
MPLRRVLDEKHSISIDRYFPKTLQGGGGYRYRVLLGVGGNIGDVKRRMNHLWFYIRRLSL
MKIVRSGVILRNPPFGYTEQHDFENTVIEIATSLEPRALLRLIWRIEKRFGRRRSFANAP
RTLDLDILFFEKRSIRSKELTIPHPHWNERISVTIPLGSLAHKSTRRHYENFDI
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgcctttacgccgtgttctcgatgagaagcactctatttcaatcgaccgttatttcccc
aaaacgcttcaggggggaggcggttatcgttaccgcgtccttctaggggttgggggaaat
atcggagatgtcaaacggcggatgaaccatttgtggttttatattcgtcgattgagtctt
atgaagatcgttcgaagcggcgtaattctccgtaatccccctttcggatatacggagcaa
cacgattttgagaataccgttatcgaaatcgcgacatcactggaacccagagcactgtta
cggctgatttggcggatagaaaaacgttttgggcggcgtcgcagttttgcgaatgcgccg
aggacgttagacttggatatactattctttgagaaacgatccattcggagcaaagagttg
acaattccccatcctcattggaatgagcggatcagtgtgacgattccgctaggaagcttg
gctcataagagcacacggagacactatgaaaattttgacatttag

DBGET integrated database retrieval system