KEGG   Sulfuricurvum kujiense: Sulku_0662Help
Entry
Sulku_0662        CDS       T01370                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
sku  Sulfuricurvum kujiense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649032..649970
Genome map
AA seq 312 aa AA seqDB search
MDSSSIYQKVLEIHDHAMGLLRSTKIPPYPSQYKKFFDQLFSEIADEQLRKDQENVDQKV
LGDSKEDVTKYLDMVEHSVVSFIQAHSGIASVAELQRQYIDTASSESADKFVTFIEGLSA
LNQTMSDELGKAQLQIDYLTKELHEARSALTTDPLTKVGNRQGFSEDIESSIEAGASKQL
SMVLMMMDIDNFKFLNDEYGYVAGDKVLYFIAQTIKGMIRSGDKVYRFGGEEFAVVLNRC
DVAQAQAIADKIRLKIEKSRLIYSGKNVHVTVSVGVTVHQAGDTLDDLIGRADKALYCAK
KSNKNCTVLFDW
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatagcagtagtatttatcagaaagttttagaaattcatgatcatgcgatgggttta
ttgcgttccaccaaaattcctccgtatccgtcacaatataaaaagttttttgatcagctt
ttttcagaaattgccgacgaacagctccgtaaagatcaggagaatgtagatcaaaaagtt
ctcggcgattcgaaagaagatgtaaccaaataccttgatatggttgaacattccgttgtc
tcttttatccaagcgcattcgggcatagcatccgttgctgagctgcagcgccaatacatc
gataccgcttcctccgagtcagccgataaattcgtgacgtttatcgaagggttgagtgca
cttaatcaaacgatgtctgatgaactcggcaaagctcaattgcagattgattatttgacg
aaagagctgcatgaagcccgttccgcccttacgaccgatccgttgaccaaagtcggaaac
cgtcaaggtttttccgaggatattgaatcttcaatcgaagcgggcgcgagcaaacagctc
tccatggtgctcatgatgatggatatagacaattttaaatttttaaacgatgaatacggt
tatgtggcgggagataaagtactttattttattgcccagacgataaaagggatgatccgc
tccggagataaagtttaccgtttcggaggagaagagttcgccgttgttcttaaccgttgc
gatgtagcgcaggcacaggcgattgccgataaaattcgtttaaaaatcgaaaaaagccgt
ctgatatattcgggtaaaaacgtccatgtgacggttagtgtcggagtaacggtccatcag
gcgggggatacgttggacgatcttatcggacgtgccgacaaagcgctttactgtgctaaa
aaatcgaataaaaactgtacggtactatttgattggtaa

DBGET integrated database retrieval system