KEGG   Sulfuricurvum kujiense: Sulku_0662Help
Entry
Sulku_0662        CDS       T01370                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
sku  Sulfuricurvum kujiense
Brite
Enzymes [BR:sku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Sulku_0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
649032..649970
Genome map
AA seq 312 aa AA seqDB search
MDSSSIYQKVLEIHDHAMGLLRSTKIPPYPSQYKKFFDQLFSEIADEQLRKDQENVDQKV
LGDSKEDVTKYLDMVEHSVVSFIQAHSGIASVAELQRQYIDTASSESADKFVTFIEGLSA
LNQTMSDELGKAQLQIDYLTKELHEARSALTTDPLTKVGNRQGFSEDIESSIEAGASKQL
SMVLMMMDIDNFKFLNDEYGYVAGDKVLYFIAQTIKGMIRSGDKVYRFGGEEFAVVLNRC
DVAQAQAIADKIRLKIEKSRLIYSGKNVHVTVSVGVTVHQAGDTLDDLIGRADKALYCAK
KSNKNCTVLFDW
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatagcagtagtatttatcagaaagttttagaaattcatgatcatgcgatgggttta
ttgcgttccaccaaaattcctccgtatccgtcacaatataaaaagttttttgatcagctt
ttttcagaaattgccgacgaacagctccgtaaagatcaggagaatgtagatcaaaaagtt
ctcggcgattcgaaagaagatgtaaccaaataccttgatatggttgaacattccgttgtc
tcttttatccaagcgcattcgggcatagcatccgttgctgagctgcagcgccaatacatc
gataccgcttcctccgagtcagccgataaattcgtgacgtttatcgaagggttgagtgca
cttaatcaaacgatgtctgatgaactcggcaaagctcaattgcagattgattatttgacg
aaagagctgcatgaagcccgttccgcccttacgaccgatccgttgaccaaagtcggaaac
cgtcaaggtttttccgaggatattgaatcttcaatcgaagcgggcgcgagcaaacagctc
tccatggtgctcatgatgatggatatagacaattttaaatttttaaacgatgaatacggt
tatgtggcgggagataaagtactttattttattgcccagacgataaaagggatgatccgc
tccggagataaagtttaccgtttcggaggagaagagttcgccgttgttcttaaccgttgc
gatgtagcgcaggcacaggcgattgccgataaaattcgtttaaaaatcgaaaaaagccgt
ctgatatattcgggtaaaaacgtccatgtgacggttagtgtcggagtaacggtccatcag
gcgggggatacgttggacgatcttatcggacgtgccgacaaagcgctttactgtgctaaa
aaatcgaataaaaactgtacggtactatttgattggtaa

DBGET integrated database retrieval system