KEGG   Sulfuricurvum kujiense: Sulku_0666Help
Entry
Sulku_0666        CDS       T01370                                 

Definition
(GenBank) ATP citrate lyase subunit 1
  KO
K15231  ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00020  Citrate cycle (TCA cycle)
sku00720  Carbon fixation pathways in prokaryotes
sku01100  Metabolic pathways
sku01110  Biosynthesis of secondary metabolites
sku01120  Microbial metabolism in diverse environments
sku01130  Biosynthesis of antibiotics
sku01200  Carbon metabolism
Module
sku_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sulku_0666
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Sulku_0666
Enzymes [BR:sku01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Sulku_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_bind ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: ADR33332
UniProt: E4U0V6
Position
652955..654271
Genome map
AA seq 438 aa AA seqDB search
MAQRAIREYDGKAIFSKHWEKYFSGFHYGFKSVLVTNGDELRACAQKHGFEWLKQEALVA
KPDMLFGKRGKNDLVLFKTNKPGDVTLEDAAKWIDEKISHETTLLSGQHGTLTHFIIEPF
TPHSQDQEYYISATTVGEDDVLYLSAEGGMEVEEGWEEKVNEVTIPITMDDANIAHLIRA
NVPAGIPAENKERFITFAEQFYKFYRDLNFAYLEINPIVMIGNDMHILDLVARLDDTAGF
MMGESWCGAEFPTAFGMEDQSPEEKAIAEADSKSGASLKLTILNPMGRIWTMVAGGGASV
VYADTIADLSGNVADLANYGEYSGGPTTGETKFYADTVLDLMTRHKDPKGRDKILIIGGA
IANFTDVAKTFTGIIQSFETYAEKMKAVGTRIYVRRGGPNYEKGLKDIKEAADRLGLYIE
VYGPETHVTDIVRMALEK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaagagcgattcgtgaatacgacggtaaagcaattttctctaaacattgggaa
aaatacttcagtgggtttcattacggttttaaatcagtattggtaaccaatggtgatgaa
ttacgtgcatgtgcgcaaaaacacggttttgaatggctaaaacaagaagctttggttgct
aaaccggatatgctattcggtaaacgcggtaaaaatgacttggtattgttcaaaaccaac
aaaccgggcgatgtaactcttgaagatgcggcaaaatggattgacgaaaaaatttctcac
gaaacgactcttctctcgggacaacacggaactttgacacactttatcattgagccgttc
actcctcactcacaagatcaagagtactatatttcagcaacgacagtcggtgaagacgat
gttctttatctatcggctgagggcggtatggaagttgaagaaggatgggaagagaaagtt
aatgaagtaacgattcctattacgatggacgatgcaaacatcgctcaccttatccgtgcc
aatgttcctgcgggaattccggcggaaaataaagagcgttttatcacatttgcagagcaa
ttttataaattttaccgtgatttgaatttcgcatatcttgaaatcaatccgatcgttatg
atcggtaacgatatgcacatccttgaccttgttgcacgtcttgatgatacggcaggcttc
atgatgggtgagtcatggtgcggtgcagaattcccgacggcattcggaatggaagaccaa
tctccggaagaaaaagcgatcgcggaagcggactcgaaatcgggtgcttcattgaaattg
actatccttaaccctatgggacgtatctggacgatggttgcgggcggtggtgcatcggtt
gtttatgccgacaccattgctgacctttcaggaaatgttgctgatcttgcgaactacggt
gagtactccggcggaccgacaacgggtgaaacgaaattctatgccgacacggttttggat
ttgatgactcgtcataaggatccgaaagggcgcgataaaattcttatcatcggcggtgcg
attgcaaactttaccgatgtcgcgaaaacctttaccggtattatccaatcgtttgaaacc
tatgcagagaaaatgaaagcggtcggaacccgtatttacgtacgtcgcggcggaccgaat
tatgaaaaaggtttgaaagacatcaaagaagcggcagaccgtttgggtctctatatcgaa
gtttatgggccagaaacacacgtaacggatatcgtacgtatggctctagagaagtaa

DBGET integrated database retrieval system