KEGG   Sulfuricurvum kujiense: Sulku_0666Help
Entry
Sulku_0666        CDS       T01370                                 

Definition
ATP citrate lyase subunit 1 (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
sku  Sulfuricurvum kujiense
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulku_0666
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sulku_0666
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Sulku_0666
Enzymes [BR:sku01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Sulku_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
652955..654271
Genome map
AA seq 438 aa AA seqDB search
MAQRAIREYDGKAIFSKHWEKYFSGFHYGFKSVLVTNGDELRACAQKHGFEWLKQEALVA
KPDMLFGKRGKNDLVLFKTNKPGDVTLEDAAKWIDEKISHETTLLSGQHGTLTHFIIEPF
TPHSQDQEYYISATTVGEDDVLYLSAEGGMEVEEGWEEKVNEVTIPITMDDANIAHLIRA
NVPAGIPAENKERFITFAEQFYKFYRDLNFAYLEINPIVMIGNDMHILDLVARLDDTAGF
MMGESWCGAEFPTAFGMEDQSPEEKAIAEADSKSGASLKLTILNPMGRIWTMVAGGGASV
VYADTIADLSGNVADLANYGEYSGGPTTGETKFYADTVLDLMTRHKDPKGRDKILIIGGA
IANFTDVAKTFTGIIQSFETYAEKMKAVGTRIYVRRGGPNYEKGLKDIKEAADRLGLYIE
VYGPETHVTDIVRMALEK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaagagcgattcgtgaatacgacggtaaagcaattttctctaaacattgggaa
aaatacttcagtgggtttcattacggttttaaatcagtattggtaaccaatggtgatgaa
ttacgtgcatgtgcgcaaaaacacggttttgaatggctaaaacaagaagctttggttgct
aaaccggatatgctattcggtaaacgcggtaaaaatgacttggtattgttcaaaaccaac
aaaccgggcgatgtaactcttgaagatgcggcaaaatggattgacgaaaaaatttctcac
gaaacgactcttctctcgggacaacacggaactttgacacactttatcattgagccgttc
actcctcactcacaagatcaagagtactatatttcagcaacgacagtcggtgaagacgat
gttctttatctatcggctgagggcggtatggaagttgaagaaggatgggaagagaaagtt
aatgaagtaacgattcctattacgatggacgatgcaaacatcgctcaccttatccgtgcc
aatgttcctgcgggaattccggcggaaaataaagagcgttttatcacatttgcagagcaa
ttttataaattttaccgtgatttgaatttcgcatatcttgaaatcaatccgatcgttatg
atcggtaacgatatgcacatccttgaccttgttgcacgtcttgatgatacggcaggcttc
atgatgggtgagtcatggtgcggtgcagaattcccgacggcattcggaatggaagaccaa
tctccggaagaaaaagcgatcgcggaagcggactcgaaatcgggtgcttcattgaaattg
actatccttaaccctatgggacgtatctggacgatggttgcgggcggtggtgcatcggtt
gtttatgccgacaccattgctgacctttcaggaaatgttgctgatcttgcgaactacggt
gagtactccggcggaccgacaacgggtgaaacgaaattctatgccgacacggttttggat
ttgatgactcgtcataaggatccgaaagggcgcgataaaattcttatcatcggcggtgcg
attgcaaactttaccgatgtcgcgaaaacctttaccggtattatccaatcgtttgaaacc
tatgcagagaaaatgaaagcggtcggaacccgtatttacgtacgtcgcggcggaccgaat
tatgaaaaaggtttgaaagacatcaaagaagcggcagaccgtttgggtctctatatcgaa
gtttatgggccagaaacacacgtaacggatatcgtacgtatggctctagagaagtaa

DBGET integrated database retrieval system