KEGG   Sulfuricurvum kujiense: Sulku_0740Help
Entry
Sulku_0740        CDS       T01370                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sku  Sulfuricurvum kujiense
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulku_0740
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sulku_0740
Enzymes [BR:sku01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Sulku_0740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
735284..736381
Genome map
AA seq 365 aa AA seqDB search
MNVIELFKKLLESPSVTPEDGGIFEFLEEYLEGFTTIRIDREGVKNLFAYRTFGEGKHLC
FAGHVDVVPAGEGWESDPFIATEKDGYIYARGAQDMKSGVAAFVQALKETDTFEGTLSVL
LTSDEEGPAKFGTVEVLAYLKEHNLLPDAVIVAEPTCEVQFGDAIKVGRRGSINGIIEMI
GKQGHAAYPEKAINPVHQIASVLSKIAGAFLDNGDEYFAPSQIVITDIRAGIETTNVSPG
KLKMMFNVRNSTRTDQEKIKSFIAEQMGELEYTLALDQSAYPFVTDADTEIVRTLSNAIA
DVCGRVPKNSTAGGTSDARFIAAYEIDVIEFGVINDTIHAPNERTSIAEVENLYAVFTKL
INNFR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgttattgaattatttaaaaagcttttggaatcgccgagcgttactcctgaagac
ggcggtatttttgaatttctggaagagtatttggaaggatttacgactattcgaatcgat
cgcgaaggggtaaaaaatctttttgcctatcgtacgtttggtgagggaaaacatctttgt
ttcgccgggcatgtcgatgtcgttcccgcaggggaggggtgggagagtgatccgtttatc
gcaaccgaaaaagacggatacatctacgcccgcggcgcacaggatatgaaaagcggcgtt
gccgctttcgtccaagcattgaaagagacagatacatttgaggggaccttgtcggttttg
ctcacctctgacgaggagggaccggccaaattcggtacggtagaagtattggcgtatctc
aaagaacataatctcctccccgacgccgttatcgtagccgaaccgacgtgcgaagtgcaa
ttcggggatgcgatcaaagtcggtcgtcgcggatcgatcaacggaatcatcgagatgatc
gggaaacagggacacgcggcttatccggaaaaagcgatcaacccggtacatcagattgcc
tccgtgttatcaaaaatcgcgggtgcttttttggataacggggatgaatatttcgctccg
agccaaatcgtcattaccgatatccgtgcggggatcgagacgactaacgtctctcccgga
aaactgaaaatgatgtttaacgtccgcaattcgacccgtaccgatcaggagaagataaaa
tcctttattgcggaacagatgggagaattggagtatacgttggcattggatcagtcggcc
tatccgtttgtgaccgatgccgatacggagattgtacgaactctttcaaacgctattgcc
gatgtgtgcggaagggttccgaaaaattctacggccggaggaacatcagacgcgagattc
attgcggcatacgagatagatgttattgaattcggcgttattaacgatacgatacatgcc
cccaatgagcggacatcgattgcggaagtggaaaatctttatgctgtttttacaaagtta
attaataattttcggtaa

DBGET integrated database retrieval system