KEGG   Sulfuricurvum kujiense: Sulku_0749Help
Entry
Sulku_0749        CDS       T01370                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sku  Sulfuricurvum kujiense
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulku_0749
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sulku_0749
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Sulku_0749
Enzymes [BR:sku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Sulku_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
743298..744068
Genome map
AA seq 256 aa AA seqDB search
MKRIVVKVGSAVLSEQNRIAKDRMQNLVDFIAELKKQYEVILVSSGAVAAGYTELKLDKK
VLANKQALASIGQPILMNKYRKMFEHYNILPSQILVTAANFNTDEESQKAKDTIETLLKH
NVVPIINENDATATEELVLGDNDQLSAYAAHHFGADLLVILSDIDAYYDKDPRTYSDAKV
RSRIESITSDELSMQVSPNHNFATGGIVTKLKAADFLLKRGGAMFLASGFDLSDAKSFLI
ACEHRGGSLFKATEEI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggatcgtcgttaaagtcggcagtgcggttttaagcgaacaaaacagaatcgca
aaagaccgtatgcaaaatttggtcgattttattgcggaactaaaaaaacagtatgaagtt
attttagtttcatcgggtgcagtagctgcaggctataccgagctcaaactcgataaaaaa
gtgttggcgaacaagcaggcactcgcatcgatcggacagccgattttaatgaacaaatac
cgcaagatgtttgaacactacaatatactcccttcccaaatattggtaacggcagcaaac
tttaatacggacgaagagtctcaaaaagcaaaagatacgattgagactctcttaaagcat
aatgttgtccctattattaatgaaaacgatgccacggcaacggaagagttggtattgggt
gacaatgatcagctctccgcctatgcggctcaccatttcggagccgatttgttggtgatt
ctttccgatatcgatgcctattatgataaagacccgcgtacctacagcgatgcgaaagta
cgttcgcgtattgagtcgataacttccgatgaactctccatgcaggtttctccgaaccat
aattttgcgaccggcggtattgtgacgaaactcaaagcagccgattttctccttaagcgc
ggcggtgcaatgttcttagccagcggttttgatttgagtgatgccaaaagctttttgatc
gcgtgtgagcatcgcggaggcagtctgtttaaagcaacagaggagatttaa

DBGET integrated database retrieval system