KEGG   Sulfuricurvum kujiense: Sulku_0940Help
Entry
Sulku_0940        CDS       T01370                                 

Definition
holliday junction DNA helicase subunit ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sku  Sulfuricurvum kujiense
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sku00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sulku_0940
Enzymes [BR:sku01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Sulku_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
948408..948971
Genome map
AA seq 187 aa AA seqDB search
MIIGLDGIIEYKEPSSVHLNVNGVIYEVFISLHTYSSIGSEKVKLHTHHVIREDAQQLYG
FEQKSEKILFEGMLKINGIGPKAALAICSTFTPEQFAGIISSKDINALKKVPGIGPKSAG
RIMVELAGFDAVLLGSGITATTATTEASMALEALGFKKEQIGKALSASGATDTAALVKDA
LKQLQKL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattataggattagatgggattatagagtataaagagccgtcgtcggttcatttgaat
gtcaacggcgtgatttacgaggtgtttatttcgttgcacacctacagcagcatcggctcc
gagaaggttaagctgcacacgcatcatgtgattcgcgaggatgcccaacagctttacgga
tttgaacaaaaaagcgaaaaaattctctttgaggggatgctgaaaatcaacggaataggg
ccgaaagccgcccttgctatctgcagcacctttacgccggagcagtttgcgggtattatt
tcatctaaagatatcaatgcgctcaaaaaagttccggggatcggacctaaaagtgccggt
cgtattatggtcgaactggccgggttcgatgccgtgctgctaggttcgggaataaccgct
acaacggctacgacggaagcatcgatggcgttagaagcgctcggatttaaaaaagagcag
atcggcaaagcgctcagtgcttcaggtgcaaccgatacggcggcattggtgaaagacgca
ttgaaacaacttcaaaaactctaa

DBGET integrated database retrieval system