KEGG   Sulfuricurvum kujiense: Sulku_1019Help
Entry
Sulku_1019        CDS       T01370                                 

Definition
(RefSeq) l-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulku_1019
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulku_1019
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sulku_1019
Enzymes [BR:sku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sulku_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1023157..1024626
Genome map
AA seq 489 aa AA seqDB search
MKFIETRGNDGIHPQQVTFSEAILSPIASFGGLYVPSSLPMLGEPFLTKHLNSSYKELAK
DLLTTLAIDIDGSVIDEALSLYDKFDDPTNPVPVVKVRDDLYVSELYHGPTRAFKDMALQ
PFGVVLSSIAQKRGEEYLILAATSGDTGPAALETFKNRANVRVACLYPDGGTSDVQRLQM
VTEDASNLKVIGIKGDFDDAQSALKKLLASQTFKDALKAKNISLSAANSVNFGRIIFQII
YHIHSYLELVRQNVIAMGEKVYLDVPSGNFGNALGGYYAYKMGLPVEKIIIASNENNVLT
RLINTGRYDLRGEHVVATTSPAMDILISSNVERILFDLFGYERTKELMAGLEAERFYALS
DNETMKLQNLFTADYCNGAEGKGYIKEAFDHGYLMDPHTATCFKAYDCCATKPLKTIVYS
TAEWTKFSPTIANALTGEKDANDIDALESISTTAKTPIPAMIKGLFSKPVTQATVIEKEN
IEAEILKFL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttattgaaacacgcggaaatgacggaatccatccacagcaggtgactttttca
gaggcgattttaagtcctatcgcatcgttcggcgggttgtatgtccccagcagccttccg
atgttgggtgagccgtttcttacgaaacatctgaattcatcctataaagagttggcaaaa
gatttgttgacaacacttgcgatcgatattgacggatcggtcattgacgaagcactgtca
ctttacgataaatttgatgatccgaccaatcctgtaccggttgtcaaagttcgtgatgat
ctttatgtaagcgagctctatcacggtccgacccgtgcgttcaaagacatggcgttgcag
ccgttcggtgtcgtactcagctccatcgcccaaaagcgcggtgaagagtatctgattttg
gcagcaaccagcggtgataccggtcctgcggcgctagagacgttcaaaaacagagcgaac
gtccgtgtcgcctgcctctatcctgacggcggtacgtcggatgttcagcgtcttcagatg
gtgaccgaggatgcctcaaatctcaaagtaatcgggatcaaaggggattttgatgatgct
caaagcgcattgaaaaagcttttggcgtctcaaacgtttaaggatgccctgaaagcgaaa
aatatctccctctctgcggcaaactcggtcaacttcggacggatcatttttcaaatcatc
tatcacatccacagctaccttgaactcgttcgccaaaacgtcatcgcaatgggtgaaaaa
gtctatcttgatgttccgagcgggaatttcgggaatgcgctgggcggatattacgcctat
aaaatgggtcttccggtcgagaaaatcattatcgcttcgaatgagaacaatgttttgacc
cgtttgatcaatacggggcgctatgatctgcgtggggagcatgtcgtcgctacgacatcc
ccggctatggatattttgatctccagcaatgtcgagcgcatcttgttcgatctcttcgga
tatgagcgtaccaaagagctgatggcagggttggaagcggaacgtttctatgcgcttagc
gataatgagacgatgaaactgcaaaacctttttacggccgattactgtaacggcgccgag
gggaaagggtatatcaaagaggcattcgatcacggctatttgatggatccgcatacggcg
acctgtttcaaagcgtatgactgctgtgcgaccaaaccgcttaaaacaatcgtttactcg
actgccgagtggacgaagttttctccgacgatcgccaatgctcttacgggtgagaaagac
gctaacgatatcgatgcattggaatccatttcaacgacagctaaaacaccgatccctgcg
atgattaaagggctgtttagcaaaccggttactcaggcaacggtaatcgaaaaagagaat
attgaagctgaaattctaaaatttttataa

DBGET integrated database retrieval system