KEGG   Sulfuricurvum kujiense: Sulku_1019Help
Entry
Sulku_1019        CDS       T01370                                 

Definition
l-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulku_1019
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulku_1019
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sulku_1019
Enzymes [BR:sku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sulku_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1023157..1024626
Genome map
AA seq 489 aa AA seqDB search
MKFIETRGNDGIHPQQVTFSEAILSPIASFGGLYVPSSLPMLGEPFLTKHLNSSYKELAK
DLLTTLAIDIDGSVIDEALSLYDKFDDPTNPVPVVKVRDDLYVSELYHGPTRAFKDMALQ
PFGVVLSSIAQKRGEEYLILAATSGDTGPAALETFKNRANVRVACLYPDGGTSDVQRLQM
VTEDASNLKVIGIKGDFDDAQSALKKLLASQTFKDALKAKNISLSAANSVNFGRIIFQII
YHIHSYLELVRQNVIAMGEKVYLDVPSGNFGNALGGYYAYKMGLPVEKIIIASNENNVLT
RLINTGRYDLRGEHVVATTSPAMDILISSNVERILFDLFGYERTKELMAGLEAERFYALS
DNETMKLQNLFTADYCNGAEGKGYIKEAFDHGYLMDPHTATCFKAYDCCATKPLKTIVYS
TAEWTKFSPTIANALTGEKDANDIDALESISTTAKTPIPAMIKGLFSKPVTQATVIEKEN
IEAEILKFL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttattgaaacacgcggaaatgacggaatccatccacagcaggtgactttttca
gaggcgattttaagtcctatcgcatcgttcggcgggttgtatgtccccagcagccttccg
atgttgggtgagccgtttcttacgaaacatctgaattcatcctataaagagttggcaaaa
gatttgttgacaacacttgcgatcgatattgacggatcggtcattgacgaagcactgtca
ctttacgataaatttgatgatccgaccaatcctgtaccggttgtcaaagttcgtgatgat
ctttatgtaagcgagctctatcacggtccgacccgtgcgttcaaagacatggcgttgcag
ccgttcggtgtcgtactcagctccatcgcccaaaagcgcggtgaagagtatctgattttg
gcagcaaccagcggtgataccggtcctgcggcgctagagacgttcaaaaacagagcgaac
gtccgtgtcgcctgcctctatcctgacggcggtacgtcggatgttcagcgtcttcagatg
gtgaccgaggatgcctcaaatctcaaagtaatcgggatcaaaggggattttgatgatgct
caaagcgcattgaaaaagcttttggcgtctcaaacgtttaaggatgccctgaaagcgaaa
aatatctccctctctgcggcaaactcggtcaacttcggacggatcatttttcaaatcatc
tatcacatccacagctaccttgaactcgttcgccaaaacgtcatcgcaatgggtgaaaaa
gtctatcttgatgttccgagcgggaatttcgggaatgcgctgggcggatattacgcctat
aaaatgggtcttccggtcgagaaaatcattatcgcttcgaatgagaacaatgttttgacc
cgtttgatcaatacggggcgctatgatctgcgtggggagcatgtcgtcgctacgacatcc
ccggctatggatattttgatctccagcaatgtcgagcgcatcttgttcgatctcttcgga
tatgagcgtaccaaagagctgatggcagggttggaagcggaacgtttctatgcgcttagc
gataatgagacgatgaaactgcaaaacctttttacggccgattactgtaacggcgccgag
gggaaagggtatatcaaagaggcattcgatcacggctatttgatggatccgcatacggcg
acctgtttcaaagcgtatgactgctgtgcgaccaaaccgcttaaaacaatcgtttactcg
actgccgagtggacgaagttttctccgacgatcgccaatgctcttacgggtgagaaagac
gctaacgatatcgatgcattggaatccatttcaacgacagctaaaacaccgatccctgcg
atgattaaagggctgtttagcaaaccggttactcaggcaacggtaatcgaaaaagagaat
attgaagctgaaattctaaaatttttataa

DBGET integrated database retrieval system