KEGG   Sulfuricurvum kujiense: Sulku_1123Help
Entry
Sulku_1123        CDS       T01370                                 

Definition
cheb methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sku  Sulfuricurvum kujiense
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sku00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sulku_1123
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sulku_1123
Enzymes [BR:sku01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sulku_1123
Two-component system [BR:sku02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Sulku_1123
Bacterial motility proteins [BR:sku02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sulku_1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1117282..1117860
Genome map
AA seq 192 aa AA seqDB search
MNISSLILIGASTGGPGRIYSILSALESHFVGSVVIAQHMSAPFIPSFINQLQSIVSLPI
ISVNEPQKIKRAHIYVCSVTSELVLKGGEVWIEPMEEGDYPYNPQIDRLFASASSLPASM
RRLGIILTGIGDDGALGALSLYESGGECLFESEESSIVYGMPRRAKELVSNAHVAGIVEI
IERIKDFGGCRV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatcatcattaatccttatcggagcatcaacaggcggtccgggtcgaatttat
tcgattctttcggcattggagagtcattttgtcggctctgtcgtcatagcgcagcatatg
agcgctccgtttatccccagttttatcaatcagcttcaatctatcgtttcgcttcctatc
atttctgtcaatgaacctcaaaagataaaacgagcgcatatttatgtctgctccgttacg
tccgagttggttcttaaaggcggcgaagtatggattgaaccgatggaagagggtgattac
ccctataatcctcaaatcgatcggttattcgcatccgcatcgtctctccccgcatctatg
agacgcttagggattattttgaccggaatcggtgatgacggtgccctcggtgccttgtct
ctttatgaatcaggcggagaatgcctttttgaaagtgaagaaagttctatcgtatacggg
atgccgcggcgtgctaaagagctggtaagcaatgcgcatgtcgcgggaatcgtagagata
atagagcggatcaaagatttcggagggtgccgtgtttag

DBGET integrated database retrieval system