KEGG   Sulfuricurvum kujiense: Sulku_1123Help
Entry
Sulku_1123        CDS       T01370                                 

Definition
cheb methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sku  Sulfuricurvum kujiense
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sku02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sku02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1117282..1117860
Genome map
AA seq 192 aa AA seqDB search
MNISSLILIGASTGGPGRIYSILSALESHFVGSVVIAQHMSAPFIPSFINQLQSIVSLPI
ISVNEPQKIKRAHIYVCSVTSELVLKGGEVWIEPMEEGDYPYNPQIDRLFASASSLPASM
RRLGIILTGIGDDGALGALSLYESGGECLFESEESSIVYGMPRRAKELVSNAHVAGIVEI
IERIKDFGGCRV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatcatcattaatccttatcggagcatcaacaggcggtccgggtcgaatttat
tcgattctttcggcattggagagtcattttgtcggctctgtcgtcatagcgcagcatatg
agcgctccgtttatccccagttttatcaatcagcttcaatctatcgtttcgcttcctatc
atttctgtcaatgaacctcaaaagataaaacgagcgcatatttatgtctgctccgttacg
tccgagttggttcttaaaggcggcgaagtatggattgaaccgatggaagagggtgattac
ccctataatcctcaaatcgatcggttattcgcatccgcatcgtctctccccgcatctatg
agacgcttagggattattttgaccggaatcggtgatgacggtgccctcggtgccttgtct
ctttatgaatcaggcggagaatgcctttttgaaagtgaagaaagttctatcgtatacggg
atgccgcggcgtgctaaagagctggtaagcaatgcgcatgtcgcgggaatcgtagagata
atagagcggatcaaagatttcggagggtgccgtgtttag

DBGET integrated database retrieval system