KEGG   Sulfuricurvum kujiense: Sulku_1268Help
Entry
Sulku_1268        CDS       T01370                                 

Definition
rok family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulku_1268
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulku_1268
   00052 Galactose metabolism
    Sulku_1268
   00500 Starch and sucrose metabolism
    Sulku_1268
   00520 Amino sugar and nucleotide sugar metabolism
    Sulku_1268
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sulku_1268
   00524 Butirosin and neomycin biosynthesis
    Sulku_1268
Enzymes [BR:sku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sulku_1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1281161..1282003
Genome map
AA seq 280 aa AA seqDB search
MKKLFIDIGGTHLRSEIVSEEHTAEDMVSSQEVGLLSYIDKQATLHPDISFIGISYAGQV
NNGIIAASPNINIDEYDIASVVKSRYGIPLVIDNDLNCAVRAESAYWQSDNIAALFVGTG
IGAAVIDHGSLVKGSRNMAYEIGHIPYQETPFFCGCGRNNCIELFASGSGMGKWLKHFGS
DHDLDLNRLKNSDIEEERLIASRFEDAFLHASGVLVTLANPEILVLGGGVIEQNPYLGTL
LEEKLKRYALNASLEGLRIEMSVLKNAPLEGAKLLETQNG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgtttatcgatatcggcggtacgcatttgcgcagcgagatagtgagtgaa
gagcatacggcagaggatatggtatcctcgcaggaggtcggactgctctcttatatcgat
aaacaagctacactccatccagacatctcttttatcggcatatcgtatgccgggcaggtt
aacaacgggatcattgccgcttcgccaaatattaatattgatgaatatgatattgcatcg
gtcgtaaaatcacgctacggtattccgttggtcatagacaatgatctcaattgtgccgtc
cgggccgaatcggcatactggcaatcagacaatatcgccgctctttttgtcggtacggga
atcggtgcggcggttatcgatcatggctcattggttaagggaagccgaaacatggcatat
gagatagggcatatcccatatcaggagacaccgtttttttgcggatgcggacgaaacaac
tgtatagagctttttgcatcgggctccgggatgggaaaatggctaaaacatttcggcagt
gaccatgatcttgatttgaatcggttaaaaaattcggatatcgaagaagaacgtctcatc
gcgagccgctttgaagatgcatttcttcatgcatcaggtgttttggtaaccctcgccaat
cctgaaatcctggtactgggcggaggggtgattgaacagaatccatatttgggtacacta
ttggaagaaaaattaaaacgttatgccttaaacgcttcgttagaagggttgcgtattgag
atgagtgtgttaaaaaatgcaccgcttgaaggtgcgaaattattggagacgcagaatgga
taa

DBGET integrated database retrieval system