KEGG   Sulfuricurvum kujiense: Sulku_1270Help
Entry
Sulku_1270        CDS       T01370                                 

Definition
1,4-alpha-glucan branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sku  Sulfuricurvum kujiense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sku00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1283471..1285417
Genome map
AA seq 648 aa AA seqDB search
MNTHQHHRITYEISRLSELDIYLFKEGNHTKLYDKLGSHAMEHNGISGIYFAVWAPNAAY
VSVRGDFNHYDTGSHPLKLREDESGIWEGFIEGVEQGLTYKYHIASKFHNIVHDKSDPFG
FYAEEPPKSASRVWSLENYPWDDKGWMDTRYRNNAHDAPISVYEMHVGSWRRKVEEDNRF
LTYRELAVELVSYLKEMNYTHVEFMPLSEYPFFGSWGYQVVGYFAATARFGTPQDLMYLI
DRLHQNGIGVIMDWVPSHFAVDMHGLINFDGTALYEHDDPRQGFHPEWGSIIFNYGRNEV
KSFLISSAMFWLDKYHIDGIRVDAVASMLYLNYARKEGEWIPNQYGGNENLEAIEFLKKL
NTSVYGEFSDILMIAEESTAYPMVTRPVDVGGLGFGFKWNMGWMHDSLKYMSRDPIYRQH
HHHQLTFSMWYGFDENFMLPLSHDEVVHMKGSLINKMPGDHNQKFAHLRSLLAYMMAHPG
KKLLFMGGEIAQFAEWSFERSLDWHLLDYPLHHGLQKMVSDLNALYAHERALHLYDEKRE
GFEWIDDRDYSHNCISFIRKSDDPTDNIIVVCNFADNTRENYCLGVPYAGDYVEIFNSQS
HYYEGWNIGNTSPLAAVEREMHGRPYTLTLTLPPLGVLYLKRNEGEKR
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaatactcaccaacaccatcggataacctatgagatttcgcgactgagcgaactggat
atctatttgttcaaagaaggtaaccataccaagctatacgataaactcggttctcatgcg
atggaacacaacgggatttccgggatctattttgccgtatgggcgcccaatgccgcatat
gtcagtgtccggggagatttcaaccattacgataccggctcgcatccgttaaaacttcgt
gaagacgagtcggggatatgggaaggatttatagagggagtggagcaggggctcacctac
aaatatcatatcgcctcaaaatttcataatatcgtccatgacaaaagcgatccgttcggt
ttttatgcagaagagccgccgaaatcggcatcccgtgtctggagtctggaaaactaccct
tgggacgataaaggatggatggatacacgatatcgcaacaatgcccatgatgcaccgatc
agcgtgtatgagatgcatgtcggttcatggagacgcaaagtcgaagaagacaaccgtttt
ctcacctaccgggagctagccgtagaactggtctcgtatcttaaagagatgaactatacc
catgtcgagtttatgcccctgagcgagtatccgtttttcggttcatggggatatcaggtc
gtaggatactttgcggcaacggcacgtttcggaacaccgcaggatttgatgtatctgatc
gataggctgcatcaaaacgggatcggcgttattatggactgggtaccctcacattttgcc
gtcgatatgcacggcttgattaattttgacggaacggccctgtatgagcacgacgacccc
cgacaggggtttcatcccgaatggggaagcatcattttcaactacggtcgaaacgaagta
aaatcgtttttgatctcttctgcaatgttttggctggataaataccatatcgacggcata
cgcgtcgatgcggtcgcttcaatgctttatctcaactatgcacgaaaagagggggagtgg
atccccaaccaatacggcgggaatgagaatctcgaagcgattgaatttctgaaaaaactc
aataccagtgtgtacggagaattttccgatatcctgatgatcgccgaagaatcgaccgcc
tatccgatggtgacgcgaccggtagatgtaggcgggctaggattcggatttaagtggaac
atgggatggatgcatgactcccttaaatacatgagccgtgatccgatctatcgtcaacac
catcatcaccagctcacgtttagtatgtggtacggatttgatgagaactttatgctccct
ctcagccacgatgaggtcgtccatatgaaaggctcgctcatcaacaaaatgccgggcgat
cataatcaaaaatttgcccatttgcgttcattgctagcgtatatgatggctcatcccgga
aagaaactcctgtttatggggggagagatcgcgcagttcgcggaatggagttttgaacgc
tccttggactggcatcttttggactatccgctccatcacggtttgcaaaagatggtttcc
gatttgaatgcgctctatgcacatgagcgggctttgcatttgtatgacgagaaacgcgaa
gggtttgagtggatcgatgatcgggattattcgcataactgcatcagctttatccgcaaa
agtgatgatcctaccgacaatattatcgttgtgtgcaattttgccgataatacacgggaa
aactactgtctgggtgtgccgtatgcgggagattatgtagaaatcttcaattcgcaatca
cactattatgagggttggaatatcggaaacacttcacctttagcggcggttgagagagaa
atgcacggccgtccgtacacacttacactgaccttgcctccgttaggggtactctatcta
aagcgcaacgaaggggaaaaaagatga

DBGET integrated database retrieval system