KEGG   Sulfuricurvum kujiense: Sulku_1283Help
Entry
Sulku_1283        CDS       T01370                                 

Definition
protein-l-isoaspartate(d-aspartate) o-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sku  Sulfuricurvum kujiense
Brite
Enzymes [BR:sku01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Sulku_1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1302915..1303529)
Genome map
AA seq 204 aa AA seqDB search
MQSNEQLVNYLISSGVLRSPLLINAFEKCDRILFVPDEFYPYAYEDRPLPIGRAQTISQP
YTVAIMLELLQPNVGNKILDIGSGSGWTTALLTTAVGASGFVEGIEIVPSLVEYGKQSLQ
KMGIDNASITQGTSSVLGKPGEVYDRILVSASAPKIPDTLFEQLKTEGRLVVPVQNSIWC
LTKKEDGTVDGYELPGFQFVPLIV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcagagtaatgaacagctcgttaattatctgatttcttcaggcgttctccgttccccg
ttgcttatcaatgcattcgagaaatgtgatcgcatcctttttgtccccgatgaattctat
ccgtatgcatacgaagaccgccctttgcctatcggacgagcgcaaacaatatcacaacct
tacaccgttgcgattatgcttgaacttctccaaccgaacgttggaaacaaaatattggat
atcggttcaggttcagggtggacgacggcacttctgactacggctgtcggagcgtcagga
tttgttgaagggatcgaaatcgtcccctcattggttgagtacggtaaacaaagcttgcaa
aaaatgggaatagacaacgcatctatcacacaaggcacttcttcggttctcggaaagcca
ggagaagtatatgatcgcatcctcgtttctgcaagcgcaccaaaaataccggataccctg
ttcgagcagcttaaaacggaaggaagacttgttgtccccgtccaaaacagtatttggtgc
cttacaaaaaaagaggatggaaccgttgatggctatgaactccccggatttcaattcgtc
ccgctgattgtatga

DBGET integrated database retrieval system